Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80328
Gene name	UL16 binding protein 2
Gene symbol	ULBP2
Synonyms (NCBI Gene)	ALCAN-alphaN2DL2NKG2DL2RAET1HRAET1L
Chromosome	6
Chromosome location	6q25.1
Summary	This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activa

145

Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006286	hsa-miR-34a-5p	FlowLuciferase reporter assayWestern blot	22102694
MIRT006287	hsa-miR-34c-5p	FlowLuciferase reporter assayWestern blot	22102694
MIRT006286	hsa-miR-34a-5p	FlowLuciferase reporter assayWestern blot	22102694
MIRT006286	hsa-miR-34a-5p	FlowLuciferase reporter assayWestern blot	22102694
MIRT438756	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23956116
MIRT438756	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23956116
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	23592263
MIRT316354	hsa-miR-5682	PAR-CLIP	23592263
MIRT488438	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT488437	hsa-miR-448	PAR-CLIP	23592263
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT488438	hsa-miR-153-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006286	hsa-miR-34a-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT006287	hsa-miR-34c-5p	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT488437	hsa-miR-448	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT316354	hsa-miR-5682	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	26701625
MIRT316341	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT316344	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT316345	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT488440	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT488439	hsa-miR-6884-3p	PAR-CLIP	23592263
MIRT316354	hsa-miR-5682	PAR-CLIP	23592263
MIRT488438	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT488437	hsa-miR-448	PAR-CLIP	23592263
MIRT2363202	hsa-miR-3074-3p	CLIP-seq
MIRT2363203	hsa-miR-4311	CLIP-seq
MIRT2363204	hsa-miR-450b-5p	CLIP-seq
MIRT2363205	hsa-miR-4696	CLIP-seq
MIRT2657121	hsa-miR-1178	CLIP-seq
MIRT2657122	hsa-miR-1207-3p	CLIP-seq
MIRT2657123	hsa-miR-1253	CLIP-seq
MIRT2657124	hsa-miR-1324	CLIP-seq
MIRT2657125	hsa-miR-3154	CLIP-seq
MIRT2657126	hsa-miR-338-5p	CLIP-seq
MIRT2657127	hsa-miR-3677-3p	CLIP-seq
MIRT2363203	hsa-miR-4311	CLIP-seq
MIRT2657128	hsa-miR-4435	CLIP-seq
MIRT2657129	hsa-miR-4440	CLIP-seq
MIRT2363204	hsa-miR-450b-5p	CLIP-seq
MIRT2657130	hsa-miR-4649-5p	CLIP-seq
MIRT2363205	hsa-miR-4696	CLIP-seq
MIRT2657131	hsa-miR-513a-5p	CLIP-seq
MIRT2657132	hsa-miR-579	CLIP-seq
MIRT2657121	hsa-miR-1178	CLIP-seq
MIRT2657122	hsa-miR-1207-3p	CLIP-seq
MIRT2657124	hsa-miR-1324	CLIP-seq
MIRT2657125	hsa-miR-3154	CLIP-seq
MIRT2657126	hsa-miR-338-5p	CLIP-seq
MIRT2657127	hsa-miR-3677-3p	CLIP-seq
MIRT2363203	hsa-miR-4311	CLIP-seq
MIRT2657128	hsa-miR-4435	CLIP-seq
MIRT2657129	hsa-miR-4440	CLIP-seq
MIRT2363204	hsa-miR-450b-5p	CLIP-seq
MIRT2657130	hsa-miR-4649-5p	CLIP-seq
MIRT2363205	hsa-miR-4696	CLIP-seq
MIRT2657131	hsa-miR-513a-5p	CLIP-seq
MIRT2657132	hsa-miR-579	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002476	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA
GO:0002486	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA
GO:0005515	Function	Protein binding	IPI	19424970, 28559451, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18676862
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IDA	11239445
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	18676862
GO:0016020	Component	Membrane	IEA
GO:0030101	Process	Natural killer cell activation	IDA	11239445
GO:0034235	Function	GPI anchor binding	IDA	37684232
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	17562706
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	11239445, 37774496
GO:0046703	Function	Natural killer cell lectin-like receptor binding	IDA	11239445
GO:0048018	Function	Receptor ligand activity	IDA	11777960
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
605698	14894	ENSG00000131015

Q9BZM5

Protein name

UL16-binding protein 2 (ALCAN-alpha) (NKG2D ligand 2) (N2DL-2) (NKG2DL2) (Retinoic acid early transcript 1H)

Protein function

Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

PDB

8IMX , 8IMY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00129	MHC_I	29 → 205	Class I Histocompatibility antigen, domains alpha 1 and 2	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. {ECO:0000269|PubMed:11444831}.

Sequence

MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLT
LQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAM
SFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPC
FILPGI

Sequence length

246

Interactions

View interactions

	KEGG		Reactome
	Natural killer cell mediated cytotoxicity		Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25212604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	19798433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	25212604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22257486, 33176066, 35793235, 40496857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36313765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31360109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22587355	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	26608587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24242212, 28607584, 29653552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31073530, 33646276, 33909599, 34850851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28402947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28402947, 31159706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36742322	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28684217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31655348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31655348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	19013003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29693186	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	37774496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	32144161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17391757, 18706445		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18706445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23445485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24677544, 28404876, 35003895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28404876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22587355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28523761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21625447, 31303272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25212604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18706445, 21625447, 22102694, 25024379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28607584, 29653552		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	19089914		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22102694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16210338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23308050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17470428, 21764762, 22102694, 23820258, 24242212, 25024379, 28529563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24203492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18791713, 23297870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21625447, 31303272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21625447	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27602753	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23157549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19414815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25212604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25212604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37685962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25510288, 36313765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ULBP2 (UL16 binding protein 2)