CXXC4 (CXXC finger protein 4)

Gene

• Entrez ID: 80319
• Gene name: CXXC finger protein 4
• Gene symbol: CXXC4
• Synonyms (NCBI Gene): IDAX
• Chromosome: 4
• Chromosome location: 4q24
• Summary: This gene encodes a CXXC-type zinc finger domain-containing protein that functions as an antagonist of the canonical wingless/integrated signaling pathway. The encoded protein negatively regulates wingless/integrated signaling through interaction with the

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT038653	hsa-miR-30b-3p	CLASH	23622248
MIRT445076	hsa-miR-4635	PAR-CLIP	22100165
MIRT445077	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT445075	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445074	hsa-miR-578	PAR-CLIP	22100165
MIRT441680	hsa-miR-6733-3p	PAR-CLIP	22100165
MIRT441679	hsa-miR-4302	PAR-CLIP	22100165
MIRT441677	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT441678	hsa-miR-4264	PAR-CLIP	22100165
MIRT441676	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT441675	hsa-miR-4695-3p	PAR-CLIP	22100165
MIRT445076	hsa-miR-4635	PAR-CLIP	22100165
MIRT445077	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT445075	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445074	hsa-miR-578	PAR-CLIP	22100165
MIRT441680	hsa-miR-6733-3p	PAR-CLIP	22100165
MIRT441679	hsa-miR-4302	PAR-CLIP	22100165
MIRT441677	hsa-miR-4797-3p	PAR-CLIP	22100165
MIRT441678	hsa-miR-4264	PAR-CLIP	22100165
MIRT441676	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT441675	hsa-miR-4695-3p	PAR-CLIP	22100165
MIRT2208106	hsa-miR-3617	CLIP-seq
MIRT2208107	hsa-miR-641	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IDA	11113207
GO:0005737	Component	Cytoplasm	IEA
GO:0007352	Process	Zygotic specification of dorsal/ventral axis	ISS
GO:0008270	Function	Zinc ion binding	IDA	29276034
GO:0008270	Function	Zinc ion binding	IEA
GO:0008327	Function	Methyl-CpG binding	IBA
GO:0008327	Function	Methyl-CpG binding	IDA	29276034
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030165	Function	PDZ domain binding	IPI	11113207
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IDA	11113207
GO:0031410	Component	Cytoplasmic vesicle	IDA	11113207
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 611645
• HGNC: 24593
• e!Ensembl: ENSG00000168772

Protein

• UniProt ID: Q9H2H0
• Protein name: CXXC-type zinc finger protein 4 (Inhibition of the Dvl and axin complex protein)
• Protein function: Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1 (By similarity). Binds preferentially to DNA containing cytidine-phosphate-guanosine (CpG) dinucleotides over CpH (H=A, T, and C), hemimethylated-CpG and hem
• PDB: 5VC9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02008	zf-CXXC	131 → 172	CXXC zinc finger domain	Domain

• Sequence:

  MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNL
  PERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSS
  SSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPG
  TSLERTPVPSAEAFRWFF

• Sequence length: 198

Pathways

KEGG:

Wnt signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colon Carcinoma	Colon Carcinoma	BEFREE	29337063		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30042169		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30042169	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18931698		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34076982	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	27553089	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	23308048		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17143510		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23949225, 29262584		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29337063		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25085016		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	19388938	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18931698, 23949225, 29262584, 30042169		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18931698		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27553089	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23949225, 29262584		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23949225	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33107235	Associate	★☆☆☆☆ Found in Text Mining only