Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80312
Gene name	Tet methylcytosine dioxygenase 1
Gene symbol	TET1
Synonyms (NCBI Gene)	CXXC6LCXbA119F7.1
Chromosome	10
Chromosome location	10q21.3
Summary	DNA methylation is an epigenetic mechanism that is important for controlling gene expression. The protein encoded by this gene is a demethylase that belongs to the TET (ten-eleven translocation) family. Members of the TET protein family play a role in the

260

Show/Hide all (260)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004419	hsa-miR-29b-3p	qRT-PCRLuciferase reporter assayWestern blot	19850741
MIRT004420	hsa-miR-29a-3p	qRT-PCR	19850741
MIRT030814	hsa-miR-21-5p	Microarray	18591254
MIRT039236	hsa-miR-454-3p	CLASH	23622248
MIRT037234	hsa-miR-877-5p	CLASH	23622248
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	23857059
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23820384
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23820384
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23820384
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23820384
MIRT640760	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT640759	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT640758	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT640757	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT640756	hsa-miR-421	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT640755	hsa-miR-1305	HITS-CLIP	23824327
MIRT621857	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT621856	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT621855	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT621853	hsa-miR-3686	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	27555295
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assayqRT-PCRWestern blot	27555295
MIRT382486	hsa-miR-141-3p	qRT-PCR	27198154
MIRT382486	hsa-miR-141-3p	qRT-PCR	27198154
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assayWestern blot	26776158
MIRT004420	hsa-miR-29a-3p	MicroarrayqRT-PCR	26251039
MIRT734564	hsa-miR-767-5p	Western blottingImmunohistochemistry (IHC)qRT-PCR	31844675
MIRT736345	hsa-miR-191-5p	Luciferase reporter assayWestern blottingqRT-PCR	32003827
MIRT640760	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT640759	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT640758	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT640757	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT640756	hsa-miR-421	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT640755	hsa-miR-1305	HITS-CLIP	23824327
MIRT621857	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT621856	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT621855	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT621853	hsa-miR-3686	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT755464	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingqRT-PCRImmunohistochemistry (IHC)	35978806
MIRT1418577	hsa-miR-1200	CLIP-seq
MIRT1418578	hsa-miR-128	CLIP-seq
MIRT1418579	hsa-miR-1297	CLIP-seq
MIRT1418580	hsa-miR-1303	CLIP-seq
MIRT1418581	hsa-miR-155	CLIP-seq
MIRT1418582	hsa-miR-200b	CLIP-seq
MIRT1418583	hsa-miR-200c	CLIP-seq
MIRT1418584	hsa-miR-217	CLIP-seq
MIRT1418585	hsa-miR-26a	CLIP-seq
MIRT1418586	hsa-miR-26b	CLIP-seq
MIRT1418587	hsa-miR-27a	CLIP-seq
MIRT1418588	hsa-miR-27b	CLIP-seq
MIRT1418589	hsa-miR-3120-3p	CLIP-seq
MIRT1418590	hsa-miR-3123	CLIP-seq
MIRT1418591	hsa-miR-3140-3p	CLIP-seq
MIRT1418592	hsa-miR-3646	CLIP-seq
MIRT1418593	hsa-miR-365	CLIP-seq
MIRT1418594	hsa-miR-3653	CLIP-seq
MIRT1418595	hsa-miR-3658	CLIP-seq
MIRT1418596	hsa-miR-3919	CLIP-seq
MIRT1418597	hsa-miR-3923	CLIP-seq
MIRT1418598	hsa-miR-429	CLIP-seq
MIRT1418599	hsa-miR-4418	CLIP-seq
MIRT1418600	hsa-miR-4426	CLIP-seq
MIRT1418601	hsa-miR-4436b-3p	CLIP-seq
MIRT1418602	hsa-miR-4465	CLIP-seq
MIRT1418603	hsa-miR-450b-5p	CLIP-seq
MIRT1418604	hsa-miR-452	CLIP-seq
MIRT1418605	hsa-miR-4647	CLIP-seq
MIRT1418606	hsa-miR-4662b	CLIP-seq
MIRT1418607	hsa-miR-4666-5p	CLIP-seq
MIRT1418608	hsa-miR-4668-3p	CLIP-seq
MIRT1418609	hsa-miR-4672	CLIP-seq
MIRT1418610	hsa-miR-4676-3p	CLIP-seq
MIRT1418611	hsa-miR-4680-5p	CLIP-seq
MIRT1418612	hsa-miR-4698	CLIP-seq
MIRT1418613	hsa-miR-4719	CLIP-seq
MIRT1418614	hsa-miR-4761-5p	CLIP-seq
MIRT1418615	hsa-miR-4793-3p	CLIP-seq
MIRT1418616	hsa-miR-4795-3p	CLIP-seq
MIRT1418617	hsa-miR-498	CLIP-seq
MIRT1418618	hsa-miR-507	CLIP-seq
MIRT1418619	hsa-miR-509-3-5p	CLIP-seq
MIRT1418620	hsa-miR-509-5p	CLIP-seq
MIRT1418621	hsa-miR-513a-5p	CLIP-seq
MIRT1418622	hsa-miR-548ad	CLIP-seq
MIRT1418623	hsa-miR-548c-3p	CLIP-seq
MIRT1418624	hsa-miR-557	CLIP-seq
MIRT1418625	hsa-miR-569	CLIP-seq
MIRT1418626	hsa-miR-607	CLIP-seq
MIRT1418627	hsa-miR-618	CLIP-seq
MIRT1418628	hsa-miR-628-3p	CLIP-seq
MIRT1418629	hsa-miR-630	CLIP-seq
MIRT1418630	hsa-miR-649	CLIP-seq
MIRT1418631	hsa-miR-656	CLIP-seq
MIRT2125528	hsa-miR-1276	CLIP-seq
MIRT1418580	hsa-miR-1303	CLIP-seq
MIRT2125529	hsa-miR-150	CLIP-seq
MIRT2125530	hsa-miR-183	CLIP-seq
MIRT2125531	hsa-miR-191	CLIP-seq
MIRT2125532	hsa-miR-3152-3p	CLIP-seq
MIRT2125533	hsa-miR-337-3p	CLIP-seq
MIRT2125534	hsa-miR-3662	CLIP-seq
MIRT2125535	hsa-miR-376a	CLIP-seq
MIRT2125536	hsa-miR-376b	CLIP-seq
MIRT2125537	hsa-miR-4265	CLIP-seq
MIRT2125538	hsa-miR-4296	CLIP-seq
MIRT2125539	hsa-miR-4311	CLIP-seq
MIRT2125540	hsa-miR-4321	CLIP-seq
MIRT2125541	hsa-miR-4322	CLIP-seq
MIRT2125542	hsa-miR-4417	CLIP-seq
MIRT2125543	hsa-miR-4424	CLIP-seq
MIRT2125544	hsa-miR-4464	CLIP-seq
MIRT1418603	hsa-miR-450b-5p	CLIP-seq
MIRT1418609	hsa-miR-4672	CLIP-seq
MIRT2125545	hsa-miR-4732-5p	CLIP-seq
MIRT2125546	hsa-miR-4748	CLIP-seq
MIRT2125547	hsa-miR-4775	CLIP-seq
MIRT2125548	hsa-miR-494	CLIP-seq
MIRT1418618	hsa-miR-507	CLIP-seq
MIRT2125549	hsa-miR-516a-3p	CLIP-seq
MIRT1418624	hsa-miR-557	CLIP-seq
MIRT2125550	hsa-miR-587	CLIP-seq
MIRT2125551	hsa-miR-595	CLIP-seq
MIRT2347890	hsa-miR-1273g	CLIP-seq
MIRT1418578	hsa-miR-128	CLIP-seq
MIRT2347891	hsa-miR-141	CLIP-seq
MIRT2347892	hsa-miR-200a	CLIP-seq
MIRT2347893	hsa-miR-21	CLIP-seq
MIRT2347894	hsa-miR-29a	CLIP-seq
MIRT2347895	hsa-miR-29b	CLIP-seq
MIRT2347896	hsa-miR-29c	CLIP-seq
MIRT1418589	hsa-miR-3120-3p	CLIP-seq
MIRT1418592	hsa-miR-3646	CLIP-seq
MIRT1418594	hsa-miR-3653	CLIP-seq
MIRT1418595	hsa-miR-3658	CLIP-seq
MIRT2347897	hsa-miR-3682-3p	CLIP-seq
MIRT2347898	hsa-miR-3942-5p	CLIP-seq
MIRT2347899	hsa-miR-431	CLIP-seq
MIRT2125543	hsa-miR-4424	CLIP-seq
MIRT1418600	hsa-miR-4426	CLIP-seq
MIRT2347900	hsa-miR-4503	CLIP-seq
MIRT1418605	hsa-miR-4647	CLIP-seq
MIRT1418606	hsa-miR-4662b	CLIP-seq
MIRT1418609	hsa-miR-4672	CLIP-seq
MIRT1418611	hsa-miR-4680-5p	CLIP-seq
MIRT1418612	hsa-miR-4698	CLIP-seq
MIRT2347901	hsa-miR-4703-5p	CLIP-seq
MIRT2347902	hsa-miR-4711-3p	CLIP-seq
MIRT2125545	hsa-miR-4732-5p	CLIP-seq
MIRT2347903	hsa-miR-4764-5p	CLIP-seq
MIRT2347904	hsa-miR-590-5p	CLIP-seq
MIRT1418627	hsa-miR-618	CLIP-seq
MIRT2347905	hsa-miR-892a	CLIP-seq
MIRT1418579	hsa-miR-1297	CLIP-seq
MIRT1418585	hsa-miR-26a	CLIP-seq
MIRT1418586	hsa-miR-26b	CLIP-seq
MIRT2347894	hsa-miR-29a	CLIP-seq
MIRT2347895	hsa-miR-29b	CLIP-seq
MIRT2347896	hsa-miR-29c	CLIP-seq
MIRT2433800	hsa-miR-3121-3p	CLIP-seq
MIRT2433801	hsa-miR-3159	CLIP-seq
MIRT2433802	hsa-miR-4320	CLIP-seq
MIRT1418602	hsa-miR-4465	CLIP-seq
MIRT1418616	hsa-miR-4795-3p	CLIP-seq
MIRT1418617	hsa-miR-498	CLIP-seq
MIRT1418623	hsa-miR-548c-3p	CLIP-seq
MIRT1418631	hsa-miR-656	CLIP-seq
MIRT2440941	hsa-miR-147	CLIP-seq
MIRT2347893	hsa-miR-21	CLIP-seq
MIRT2440942	hsa-miR-3691-5p	CLIP-seq
MIRT2440943	hsa-miR-3911	CLIP-seq
MIRT2440944	hsa-miR-4752	CLIP-seq
MIRT2440945	hsa-miR-4760-3p	CLIP-seq
MIRT2347904	hsa-miR-590-5p	CLIP-seq
MIRT2440946	hsa-miR-644	CLIP-seq
MIRT2347905	hsa-miR-892a	CLIP-seq
MIRT2640724	hsa-miR-127-5p	CLIP-seq
MIRT1418597	hsa-miR-3923	CLIP-seq
MIRT1418628	hsa-miR-628-3p	CLIP-seq
MIRT2640725	hsa-miR-653	CLIP-seq
MIRT2640724	hsa-miR-127-5p	CLIP-seq
MIRT1418597	hsa-miR-3923	CLIP-seq
MIRT1418628	hsa-miR-628-3p	CLIP-seq
MIRT2640725	hsa-miR-653	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	22865885
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21496894, 27251462
GO:0001826	Process	Inner cell mass cell differentiation	ISS
GO:0003677	Function	DNA binding	IDA	19372391
GO:0003677	Function	DNA binding	IEA
GO:0005506	Function	Iron ion binding	IDA	19372391
GO:0005515	Function	Protein binding	IPI	27251462, 34667079
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	19372391
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	28554894
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IMP	25284789
GO:0006493	Process	Protein O-linked glycosylation	ISS
GO:0008270	Function	Zinc ion binding	IDA	29276034
GO:0008270	Function	Zinc ion binding	IEA
GO:0008327	Function	Methyl-CpG binding	IDA	21496894, 27251462, 29276034
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016706	Function	2-oxoglutarate-dependent dioxygenase activity	IEA
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0034614	Process	Cellular response to reactive oxygen species	IDA	27251462
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IDA	21496894
GO:0044029	Process	Positive regulation of gene expression via chromosomal CpG island demethylation	IMP	21496894
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	21496894
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IBA
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IDA	19372391, 21496894
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IEA
GO:0070579	Function	DNA 5-methylcytosine dioxygenase activity	IMP	21496894, 25284789
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894

MIM	HGNC	e!Ensembl
607790	29484	ENSG00000138336

Q8NFU7

Protein name

Methylcytosine dioxygenase TET1 (EC 1.14.11.80) (CXXC-type zinc finger protein 6) (Leukemia-associated protein with a CXXC domain) (Ten-eleven translocation 1 gene protein)

Protein function

Dioxygenase that plays a key role in active DNA demethylation, by catalyzing the sequential oxidation of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC), 5-formylcytosine (5fC), and 5-carboxylcytosine (5caC)

PDB

6ASD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02008	zf-CXXC	583 → 624	CXXC zinc finger domain	Domain
PF12851	Tet_JBP	1580 → 2052	Oxygenase domain of the 2OGFeDO superfamily	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal heart, lung and brain, and in adult skeletal muscle, thymus and ovary. Not detected in adult heart, lung or brain. Up-regulated in glioblastoma cells (at protein level) (PubMed:25284789). {ECO:0000269|PubMed:12124344

Sequence

MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKK
KTEPKPPVPVRSLLTRAGAARMNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPL
VVAKSKKVPLSKGLEKQHDCDYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSL
LKGKSQETTQFWSQRVEDSKINIPTHSGPAAEILPGPLEGTRCGEGLFSEETLNDTSGSP
KMFAQDTVCAPFPQRATPKVTSQGNPSIQLEELGSRVESLKLSDSYLDPIKSEHDCYPTS
SLNKVIPDLNLRNCLALGGSTSPTSVIKFLLAGSKQATLGAKPDHQEAFEATANQQEVSD
TTSFLGQAFGAIPHQWELPGADPVHGEALGETPDLPEIPGAIPVQGEVFGTILDQQETLG
MSGSVVPDLPVFLPVPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSS
SNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSK
SDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTTLLPTLEKKKRKRCGVCEPCQQK
TNCGECTYCKNRKNSHQICKKRKCEELKKKPSVVVPLEVIKENKRPQREKKPKVLKADFD
NKPVNGPKSESMDYSRCGHGEEQKLELNPHTVENVTKNEDSMTGIEVEKWTQNKKSQLTD
HVKGDFSANVPEAEKSKNSEVDKKRTKSPKLFVQTVRNGIKHVHCLPAETNVSFKKFNIE
EFGKTLENNSYKFLKDTANHKNAMSSVATDMSCDHLKGRSNVLVFQQPGFNCSSIPHSSH
SIINHHASIHNEGDQPKTPENIPSKEPKDGSPVQPSLLSLMKDRRLTLEQVVAIEALTQL
SEAPSENSSPSKSEKDEESEQRTASLLNSCKAILYTVRKDLQDPNLQGEPPKLNHCPSLE
KQSSCNTVVFNGQTTTLSNSHINSATNQASTKSHEYSKVTNSLSLFIPKSNSSKIDTNKS
IAQGIITLDNCSNDLHQLPPRNNEVEYCNQLLDSSKKLDSDDLSCQDATHTQIEEDVATQ
LTQLASIIKINYIKPEDKKVESTPTSLVTCNVQQKYNQEKGTIQQKPPSSVHNNHGSSLT
KQKNPTQKKTKSTPSRDRRKKKPTVVSYQENDRQKWEKLSYMYGTICDIWIASKFQNFGQ
FCPHDFPTVFGKISSSTKIWKPLAQTRSIMQPKTVFPPLTQIKLQRYPESAEEKVKVEPL
DSLSLFHLKTESNGKAFTDKAYNSQVQLTVNANQKAHPLTQPSSPPNQCANVMAGDDQIR
FQQVVKEQLMHQRLPTLPGISHETPLPESALTLRNVNVVCSGGITVVSTKSEEEVCSSSF
GTSEFSTVDSAQKNFNDYAMNFFTNPTKNLVSITKDSELPTCSCLDRVIQKDKGPYYTHL
GAGPSVAAVREIMENRYGQKGNAIRIEIVVYTGKEGKSSHGCPIAKWVLRRSSDEEKVLC
LVRQRTGHHCPTAVMVVLIMVWDGIPLPMADRLYTELTENLKSYNGHPTDRRCTLNENRT
CTCQGIDPETCGASFSFGCSWSMYFNGCKFGRSPSPRRFRIDPSSPLHEKNLEDNLQSLA
TRLAPIYKQYAPVAYQNQVEYENVARECRLGSKEGRPFSGVTACLDFCAHPHRDIHNMNN
GSTVVCTLTREDNRSLGVIPQDEQLHVLPLYKLSDTDEFGSKEGMEAKIKSGAIEVLAPR
RKKRTCFTQPVPRSGKKRAAMMTEVLAHKIRAVEKKPIPRIKRKNNSTTTNNSKPSSLPT
LGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPA
PLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPGISQLGEVAPLPTLSAPVMEP
LINSEPSTGVTEPLTPHQPNHQPSFLTSPQDLASSPMEEDEQHSEADEPPSDEPLSDDPL
SPAEEKLPHIDEYWSDSEHIFLDANIGGVAIAPAHGSVLIECARRELHATTPVEHPNRNH
PTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNE
LNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV

Sequence length

2136

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TET1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (184)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	30622117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27346347, 30735628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26472283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30188753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25616722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	31616436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24012631	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29875879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	18163421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28899881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28899881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37993905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	27141042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26684294, 31089182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26684294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	32981917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	37620966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	24448211	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24448211		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	CTD_human_DG	25290267		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	25290267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26275994		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25867473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25476119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30362292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23716660, 25175940, 25362856, 25735355, 26207381, 29891505, 30809307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25735355, 26207381, 29938218, 30537986, 35440669, 37740473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	32981917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26462176, 27225590, 32390600, 32740973, 33870509, 34731191, 35835915, 37020036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28969028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33928395, 35440669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	33667646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31153371, 37181808, 37266610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33970549	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	24292451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30362292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	30249104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26931431, 27346347, 28351182, 28776568, 29088821, 30622117, 30987976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	33870509	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	38044421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26165803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37584255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26776158, 29617660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30622117	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28150354, 28851501, 30883733		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28521490, 31820855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28521490, 31820855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	26684294, 31089182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	25616722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30784212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32740973	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37932819	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29138803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	19420352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	25410542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25362856, 28513825, 29715584, 30367454, 30825236, 31842975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25362856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35395805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22320381, 26063725, 26816554, 27846738, 27977763, 29549908, 30651599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22320381, 25557833, 26816554, 27259240, 27977763, 29715584, 30651599, 32887024, 35395805, 35798829, 35858918, 36966142, 37612734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	30784212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24449578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28074830, 31728039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30651599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26356709, 27477082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25701644, 29069286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	29069286		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	28382153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27889612, 28349832, 28382153, 30849641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28349832, 30849641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34731191	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	26917261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26917261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30130982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35489280	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	31089182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28851501, 30883733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27050164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	25057885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	31623662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	28218476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25284789, 27346347, 28531272, 31278917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25284789, 27346347, 31278917, 33142244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25284789, 27346347, 28531272, 31278917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22688054, 28341638, 29659445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28341638, 31278917, 32483272, 34628789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	25867473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatomegaly	Hepatomegaly	Pubtator	35835915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29898922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28382153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24835990, 28808304, 31935962, 35942521	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25517638, 37020036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28294974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	28294974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	30130982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27477082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28397838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28194813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26253945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	30411496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	25057885, 30058675, 34644730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12124344, 23818607, 25179374, 28982308, 29100411, 29402726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23818607, 28982308, 29402726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22976956, 23818607, 28982308, 29402726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32209730	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36371552	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	27164004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12124344, 19420352, 23818607, 26791235, 29235481, 29426862, 30975912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12646957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23671639, 25616722, 25820676, 25824049, 26376879, 30551127, 31033072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25089631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27346347	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29938218, 30622117, 30987976, 31623662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28349832	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	27225590	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23716660, 25175940, 25362856, 25735355, 26207381, 29891505, 30809307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27889612, 28349832, 28382153, 30849641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	30249104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25616722, 25824049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26931431, 27346347, 28351182, 28776568, 29088821, 30622117, 30987976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28150354, 28531272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27014907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24507562, 25098926, 26462176, 27121319, 29512746, 30431097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30362292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22999938, 24939750, 25179374, 25362856, 25616722, 26165803, 26931431, 27225590, 27411465, 28513825, 28521490, 28531272, 28758831, 28851501, 29891505, 30825236, 30883733, 31820855 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28521490, 31820855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25362856, 28513825, 29715584, 30367454, 30825236, 31842975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	28524723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26294212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28228863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35798829	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	28074830, 31728039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31056718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30075814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30075814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22999938, 24507562, 24939750, 25362856, 25616722, 25735355, 25820676, 25867473, 26165803, 26294212, 26791235, 27014907, 27121319, 27225590, 27346347 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29356585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24835990, 35942521, 37347215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30045709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28776568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	28218476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	22948384, 28899881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	22948384		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obstructive azoospermia	Obstructive azoospermia	BEFREE	27141042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	27141042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31022963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30606231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29484426, 30988069		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28150354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31399111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	33870509	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	26472283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	26973719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24325350, 30948140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24325350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31022963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	26472283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	31266538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27014907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27014907, 27457352, 34844636, 37430206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	22948384, 28899881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	22948384		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	22948384	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	26165803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26165803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	27923996, 28524723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12051397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23938174, 25476119, 28899881, 30008602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23938174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25476119	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	35183246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	28218476, 28302141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	28218476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26776158, 29617660, 30622117, 31796082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24507562, 25098926, 27121319, 29512746, 30431097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26462176, 29512746, 30431097, 32017451, 36195596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	27121319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27225590	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37020036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29891505, 30809307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29891505, 35440669, 38356412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	31820855, 36692670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	34731191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	25057885		★★★★★ ★☆☆☆☆ Found in Text Mining only

TET1 (tet methylcytosine dioxygenase 1)