Gene Gene information from NCBI Gene database.
Entrez ID 80308
Gene name Flavin adenine dinucleotide synthetase 1
Gene symbol FLAD1
Synonyms (NCBI Gene)
FAD1FADSLSMFLADPP591
Chromosome 1
Chromosome location 1q21.3
Summary This gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 20
SNPs SNP information provided by dbSNP.
12
SNP ID Visualize variation Clinical significance Consequence
rs142224458 G>A Conflicting-interpretations-of-pathogenicity, likely-benign Synonymous variant, coding sequence variant, genic downstream transcript variant
rs199979286 C>T Pathogenic Stop gained, coding sequence variant
rs876661309 CCT>- Pathogenic Coding sequence variant, inframe deletion, genic downstream transcript variant
rs876661310 ->GC Pathogenic Coding sequence variant, frameshift variant
rs876661311 T>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
26
miRTarBase ID miRNA Experiments Reference
MIRT027748 hsa-miR-98-5p Microarray 19088304
MIRT032427 hsa-let-7b-5p Proteomics 18668040
MIRT032427 hsa-let-7b-5p CLASH 23622248
MIRT044739 hsa-miR-320a CLASH 23622248
MIRT037007 hsa-miR-877-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003824 Function Catalytic activity IEA
GO:0003919 Function FMN adenylyltransferase activity IBA
GO:0003919 Function FMN adenylyltransferase activity IDA 20060505, 21951714, 38688286
GO:0003919 Function FMN adenylyltransferase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610595 24671 ENSG00000160688
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NFF5
Protein name FAD synthase (EC 2.7.7.2) (FAD pyrophosphorylase) (FMN adenylyltransferase) (Flavin adenine dinucleotide synthase) [Includes: Molybdenum cofactor biosynthesis protein-like region; FAD synthase region]
Protein function Catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
PDB 8ROM , 8RON
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00994 MoCF_biosynth 114 276 Probable molybdopterin binding domain Domain
PF01507 PAPS_reduct 398 480 Phosphoadenosine phosphosulfate reductase family Family
PF01507 PAPS_reduct 463 555 Phosphoadenosine phosphosulfate reductase family Family
Sequence
MGWDLGTRLFQRQEQRSRLSRIWLEKTRVFLEGSTRTPALPHCLFWLLQVPSTQDPLFPG
YGPQCPVDLAGPPCLRPLFGGLGGYWRALQRGREGRTMTSRASELSPGRSVTAGIIIVGD
EILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEVATIAAEVTSFSNRFTHVLTAGGIG
PTHDDVTFEAVAQAFGDELKPHPKLEAATKALGGEGWEKLSLVPSSARLHYGTDPCTGQP
FRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPA
VQFHSKELYVAADEASIAPILAEA
QAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVE
QASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAV
QRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLE
AEGSMKQALGELQARHPQ
LEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILY
DRGYTSLGSRENTVR
NPALKCLSPGGHPTYRPAYLLENEEEERNSRT
Sequence length 587
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Riboflavin metabolism
Metabolic pathways
Biosynthesis of cofactors
  Vitamin B2 (riboflavin) metabolism
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
19
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
FLAD1-related disorder Likely pathogenic; Pathogenic rs771466122 RCV003407734
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple acyl-CoA dehydrogenase deficiency Pathogenic; Likely pathogenic rs876661314, rs876661313, rs876661315, rs876661312, rs876661310, rs876661311, rs876661309, rs771466122, rs199979286 RCV000223942
RCV000223949
RCV000223946
RCV000223945
RCV000223944
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Myopathy with abnormal lipid metabolism Pathogenic; Likely pathogenic rs1657723514, rs876661313, rs876661312, rs876661310, rs876661311, rs876661309, rs771466122, rs1057518160, rs199979286 RCV001542637
RCV000234837
RCV000234836
RCV000234839
RCV000234842
View all (4 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney - ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthma Asthma BEFREE 21933193, 26283408
★☆☆☆☆
Found in Text Mining only
Bipolar Disorder Bipolar Disorder BEFREE 31455761
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 34336008 Stimulate
★☆☆☆☆
Found in Text Mining only
Carbamoyl-Phosphate Synthase I Deficiency Disease Carbamoyl Phosphate Synthase Deficiency BEFREE 28433476
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 37254652 Associate
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular Diseases BEFREE 18320251, 24853887, 25008580
★☆☆☆☆
Found in Text Mining only
Coronary Arteriosclerosis Coronary Arteriosclerosis BEFREE 18842780, 21040914, 23383292, 28237083, 29074585
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease BEFREE 18842780, 21040914, 23383292, 27004414, 28237083, 29074585
★☆☆☆☆
Found in Text Mining only
Coronary heart disease Coronary Heart Disease BEFREE 18842780, 21040914, 23383292, 28237083, 29074585
★☆☆☆☆
Found in Text Mining only
Deglutition Disorders Dysphagia HPO_DG
★☆☆☆☆
Found in Text Mining only