Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80271
Gene name	Inositol-trisphosphate 3-kinase C
Gene symbol	ITPKC
Synonyms (NCBI Gene)	IP3-3KCIP3KC
Chromosome	19
Chromosome location	19q13.2
Summary	This gene encodes a member of the inositol 1,4,5-trisphosphate [Ins(1,4,5)P(3)] 3-kinase family of enzymes that catalyze the phosphorylation of inositol 1,4,5-trisphosphate to 1,3,4,5-tetrakisphosphate. The encoded protein is localized to the nucleus and

271

Show/Hide all (271)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050413	hsa-miR-23a-3p	CLASH	23622248
MIRT649623	hsa-miR-8485	HITS-CLIP	23824327
MIRT649622	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT649621	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT649620	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT649619	hsa-miR-4738-5p	HITS-CLIP	23824327
MIRT649618	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT649617	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT649616	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT649614	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT649615	hsa-miR-3660	HITS-CLIP	23824327
MIRT649613	hsa-miR-4526	HITS-CLIP	23824327
MIRT649612	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT649611	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT649610	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT649609	hsa-miR-668-5p	HITS-CLIP	23824327
MIRT649608	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT649607	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT649606	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT649605	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT736325	hsa-miR-187-3p	MicroarrayqRT-PCR	33378320
MIRT649623	hsa-miR-8485	HITS-CLIP	23824327
MIRT649622	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT649621	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT649620	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT649619	hsa-miR-4738-5p	HITS-CLIP	23824327
MIRT649618	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT649617	hsa-miR-301a-5p	HITS-CLIP	23824327
MIRT649616	hsa-miR-301b-5p	HITS-CLIP	23824327
MIRT649614	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT649615	hsa-miR-3660	HITS-CLIP	23824327
MIRT649613	hsa-miR-4526	HITS-CLIP	23824327
MIRT649612	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT649611	hsa-miR-642a-3p	HITS-CLIP	23824327
MIRT649610	hsa-miR-642b-3p	HITS-CLIP	23824327
MIRT649609	hsa-miR-668-5p	HITS-CLIP	23824327
MIRT649608	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT649607	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT649606	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT649605	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT1074925	hsa-let-7a	CLIP-seq
MIRT1074926	hsa-let-7b	CLIP-seq
MIRT1074927	hsa-let-7c	CLIP-seq
MIRT1074928	hsa-let-7d	CLIP-seq
MIRT1074929	hsa-let-7e	CLIP-seq
MIRT1074930	hsa-let-7f	CLIP-seq
MIRT1074931	hsa-let-7g	CLIP-seq
MIRT1074932	hsa-let-7i	CLIP-seq
MIRT1074933	hsa-miR-1247	CLIP-seq
MIRT1074934	hsa-miR-1976	CLIP-seq
MIRT1074935	hsa-miR-2115	CLIP-seq
MIRT1074936	hsa-miR-214	CLIP-seq
MIRT1074937	hsa-miR-216b	CLIP-seq
MIRT1074938	hsa-miR-24	CLIP-seq
MIRT1074939	hsa-miR-2467-5p	CLIP-seq
MIRT1074940	hsa-miR-3065-3p	CLIP-seq
MIRT1074941	hsa-miR-3132	CLIP-seq
MIRT1074942	hsa-miR-3170	CLIP-seq
MIRT1074943	hsa-miR-342-5p	CLIP-seq
MIRT1074944	hsa-miR-3619-5p	CLIP-seq
MIRT1074945	hsa-miR-3655	CLIP-seq
MIRT1074946	hsa-miR-370	CLIP-seq
MIRT1074947	hsa-miR-3921	CLIP-seq
MIRT1074948	hsa-miR-425	CLIP-seq
MIRT1074949	hsa-miR-4266	CLIP-seq
MIRT1074950	hsa-miR-4279	CLIP-seq
MIRT1074951	hsa-miR-4291	CLIP-seq
MIRT1074952	hsa-miR-4300	CLIP-seq
MIRT1074953	hsa-miR-4302	CLIP-seq
MIRT1074954	hsa-miR-4303	CLIP-seq
MIRT1074955	hsa-miR-4308	CLIP-seq
MIRT1074956	hsa-miR-4458	CLIP-seq
MIRT1074957	hsa-miR-4477b	CLIP-seq
MIRT1074958	hsa-miR-4500	CLIP-seq
MIRT1074959	hsa-miR-4648	CLIP-seq
MIRT1074960	hsa-miR-4651	CLIP-seq
MIRT1074961	hsa-miR-4653-5p	CLIP-seq
MIRT1074962	hsa-miR-4654	CLIP-seq
MIRT1074963	hsa-miR-4664-5p	CLIP-seq
MIRT1074964	hsa-miR-4690-3p	CLIP-seq
MIRT1074965	hsa-miR-4695-5p	CLIP-seq
MIRT1074966	hsa-miR-4720-3p	CLIP-seq
MIRT1074967	hsa-miR-4727-5p	CLIP-seq
MIRT1074968	hsa-miR-4769-5p	CLIP-seq
MIRT1074969	hsa-miR-4779	CLIP-seq
MIRT1074970	hsa-miR-516a-3p	CLIP-seq
MIRT1074971	hsa-miR-608	CLIP-seq
MIRT1074972	hsa-miR-609	CLIP-seq
MIRT1074973	hsa-miR-642b	CLIP-seq
MIRT1074974	hsa-miR-7	CLIP-seq
MIRT1074975	hsa-miR-761	CLIP-seq
MIRT1074976	hsa-miR-920	CLIP-seq
MIRT1074977	hsa-miR-922	CLIP-seq
MIRT1074978	hsa-miR-98	CLIP-seq
MIRT2018551	hsa-miR-1184	CLIP-seq
MIRT2018552	hsa-miR-1205	CLIP-seq
MIRT2018553	hsa-miR-1273g	CLIP-seq
MIRT2018554	hsa-miR-1286	CLIP-seq
MIRT2018555	hsa-miR-1321	CLIP-seq
MIRT2018556	hsa-miR-1827	CLIP-seq
MIRT2018557	hsa-miR-188-3p	CLIP-seq
MIRT2018558	hsa-miR-193a-5p	CLIP-seq
MIRT2018559	hsa-miR-1972	CLIP-seq
MIRT2018560	hsa-miR-2114	CLIP-seq
MIRT1074936	hsa-miR-214	CLIP-seq
MIRT2018561	hsa-miR-3130-5p	CLIP-seq
MIRT2018562	hsa-miR-3157-5p	CLIP-seq
MIRT2018563	hsa-miR-3158-5p	CLIP-seq
MIRT2018564	hsa-miR-3176	CLIP-seq
MIRT2018565	hsa-miR-320e	CLIP-seq
MIRT2018566	hsa-miR-3612	CLIP-seq
MIRT1074944	hsa-miR-3619-5p	CLIP-seq
MIRT2018567	hsa-miR-3918	CLIP-seq
MIRT2018568	hsa-miR-3922-3p	CLIP-seq
MIRT2018569	hsa-miR-3928	CLIP-seq
MIRT2018570	hsa-miR-4269	CLIP-seq
MIRT2018571	hsa-miR-4270	CLIP-seq
MIRT1074951	hsa-miR-4291	CLIP-seq
MIRT2018572	hsa-miR-4292	CLIP-seq
MIRT1074952	hsa-miR-4300	CLIP-seq
MIRT1074955	hsa-miR-4308	CLIP-seq
MIRT2018573	hsa-miR-4436b-3p	CLIP-seq
MIRT2018574	hsa-miR-4441	CLIP-seq
MIRT2018575	hsa-miR-4459	CLIP-seq
MIRT2018576	hsa-miR-4474-3p	CLIP-seq
MIRT2018577	hsa-miR-4482	CLIP-seq
MIRT2018578	hsa-miR-4527	CLIP-seq
MIRT2018579	hsa-miR-4650-5p	CLIP-seq
MIRT2018580	hsa-miR-4661-3p	CLIP-seq
MIRT2018581	hsa-miR-4687-3p	CLIP-seq
MIRT2018582	hsa-miR-4687-5p	CLIP-seq
MIRT1074964	hsa-miR-4690-3p	CLIP-seq
MIRT2018583	hsa-miR-4691-3p	CLIP-seq
MIRT2018584	hsa-miR-4722-5p	CLIP-seq
MIRT2018585	hsa-miR-4736	CLIP-seq
MIRT2018586	hsa-miR-4739	CLIP-seq
MIRT2018587	hsa-miR-4756-5p	CLIP-seq
MIRT2018588	hsa-miR-4757-5p	CLIP-seq
MIRT2018589	hsa-miR-4764-5p	CLIP-seq
MIRT2018590	hsa-miR-615-5p	CLIP-seq
MIRT2018591	hsa-miR-650	CLIP-seq
MIRT2018592	hsa-miR-657	CLIP-seq
MIRT1074974	hsa-miR-7	CLIP-seq
MIRT1074975	hsa-miR-761	CLIP-seq
MIRT1074976	hsa-miR-920	CLIP-seq
MIRT1074977	hsa-miR-922	CLIP-seq
MIRT2018593	hsa-miR-940	CLIP-seq
MIRT1074925	hsa-let-7a	CLIP-seq
MIRT1074926	hsa-let-7b	CLIP-seq
MIRT1074927	hsa-let-7c	CLIP-seq
MIRT1074928	hsa-let-7d	CLIP-seq
MIRT1074929	hsa-let-7e	CLIP-seq
MIRT1074930	hsa-let-7f	CLIP-seq
MIRT1074931	hsa-let-7g	CLIP-seq
MIRT1074932	hsa-let-7i	CLIP-seq
MIRT2018551	hsa-miR-1184	CLIP-seq
MIRT2018552	hsa-miR-1205	CLIP-seq
MIRT1074933	hsa-miR-1247	CLIP-seq
MIRT2250406	hsa-miR-1254	CLIP-seq
MIRT2018553	hsa-miR-1273g	CLIP-seq
MIRT2018554	hsa-miR-1286	CLIP-seq
MIRT2018555	hsa-miR-1321	CLIP-seq
MIRT2250407	hsa-miR-1322	CLIP-seq
MIRT2018556	hsa-miR-1827	CLIP-seq
MIRT2018557	hsa-miR-188-3p	CLIP-seq
MIRT2018558	hsa-miR-193a-5p	CLIP-seq
MIRT2250408	hsa-miR-197	CLIP-seq
MIRT1074936	hsa-miR-214	CLIP-seq
MIRT2250409	hsa-miR-3116	CLIP-seq
MIRT2018563	hsa-miR-3158-5p	CLIP-seq
MIRT2018565	hsa-miR-320e	CLIP-seq
MIRT2250410	hsa-miR-338-3p	CLIP-seq
MIRT2018566	hsa-miR-3612	CLIP-seq
MIRT1074944	hsa-miR-3619-5p	CLIP-seq
MIRT2018567	hsa-miR-3918	CLIP-seq
MIRT1074947	hsa-miR-3921	CLIP-seq
MIRT2018569	hsa-miR-3928	CLIP-seq
MIRT2250411	hsa-miR-3929	CLIP-seq
MIRT2250412	hsa-miR-4254	CLIP-seq
MIRT2018570	hsa-miR-4269	CLIP-seq
MIRT2018571	hsa-miR-4270	CLIP-seq
MIRT1074950	hsa-miR-4279	CLIP-seq
MIRT1074951	hsa-miR-4291	CLIP-seq
MIRT1074952	hsa-miR-4300	CLIP-seq
MIRT1074953	hsa-miR-4302	CLIP-seq
MIRT1074955	hsa-miR-4308	CLIP-seq
MIRT2250413	hsa-miR-4419b	CLIP-seq
MIRT2250414	hsa-miR-4428	CLIP-seq
MIRT2018574	hsa-miR-4441	CLIP-seq
MIRT1074956	hsa-miR-4458	CLIP-seq
MIRT2018575	hsa-miR-4459	CLIP-seq
MIRT2018576	hsa-miR-4474-3p	CLIP-seq
MIRT1074957	hsa-miR-4477b	CLIP-seq
MIRT2250415	hsa-miR-4478	CLIP-seq
MIRT1074958	hsa-miR-4500	CLIP-seq
MIRT2018578	hsa-miR-4527	CLIP-seq
MIRT2250416	hsa-miR-4530	CLIP-seq
MIRT1074959	hsa-miR-4648	CLIP-seq
MIRT1074961	hsa-miR-4653-5p	CLIP-seq
MIRT1074962	hsa-miR-4654	CLIP-seq
MIRT2018580	hsa-miR-4661-3p	CLIP-seq
MIRT2018581	hsa-miR-4687-3p	CLIP-seq
MIRT1074964	hsa-miR-4690-3p	CLIP-seq
MIRT2250417	hsa-miR-4712-5p	CLIP-seq
MIRT1074966	hsa-miR-4720-3p	CLIP-seq
MIRT2018584	hsa-miR-4722-5p	CLIP-seq
MIRT2250418	hsa-miR-4728-3p	CLIP-seq
MIRT2018585	hsa-miR-4736	CLIP-seq
MIRT2018586	hsa-miR-4739	CLIP-seq
MIRT2018587	hsa-miR-4756-5p	CLIP-seq
MIRT2018589	hsa-miR-4764-5p	CLIP-seq
MIRT1074968	hsa-miR-4769-5p	CLIP-seq
MIRT2250419	hsa-miR-485-5p	CLIP-seq
MIRT2250420	hsa-miR-548q	CLIP-seq
MIRT2250421	hsa-miR-550a	CLIP-seq
MIRT2018591	hsa-miR-650	CLIP-seq
MIRT2018592	hsa-miR-657	CLIP-seq
MIRT1074974	hsa-miR-7	CLIP-seq
MIRT1074975	hsa-miR-761	CLIP-seq
MIRT2250422	hsa-miR-770-5p	CLIP-seq
MIRT1074976	hsa-miR-920	CLIP-seq
MIRT1074977	hsa-miR-922	CLIP-seq
MIRT2018593	hsa-miR-940	CLIP-seq
MIRT1074978	hsa-miR-98	CLIP-seq
MIRT2018551	hsa-miR-1184	CLIP-seq
MIRT2018552	hsa-miR-1205	CLIP-seq
MIRT2018553	hsa-miR-1273g	CLIP-seq
MIRT2018554	hsa-miR-1286	CLIP-seq
MIRT2018558	hsa-miR-193a-5p	CLIP-seq
MIRT1074936	hsa-miR-214	CLIP-seq
MIRT2018563	hsa-miR-3158-5p	CLIP-seq
MIRT2018565	hsa-miR-320e	CLIP-seq
MIRT1074944	hsa-miR-3619-5p	CLIP-seq
MIRT1074951	hsa-miR-4291	CLIP-seq
MIRT2018575	hsa-miR-4459	CLIP-seq
MIRT2018576	hsa-miR-4474-3p	CLIP-seq
MIRT2018578	hsa-miR-4527	CLIP-seq
MIRT2018581	hsa-miR-4687-3p	CLIP-seq
MIRT2018584	hsa-miR-4722-5p	CLIP-seq
MIRT2018589	hsa-miR-4764-5p	CLIP-seq
MIRT1074974	hsa-miR-7	CLIP-seq
MIRT1074975	hsa-miR-761	CLIP-seq
MIRT1074977	hsa-miR-922	CLIP-seq
MIRT2018551	hsa-miR-1184	CLIP-seq
MIRT2018552	hsa-miR-1205	CLIP-seq
MIRT2018553	hsa-miR-1273g	CLIP-seq
MIRT2553988	hsa-miR-128	CLIP-seq
MIRT2553989	hsa-miR-1909	CLIP-seq
MIRT2018558	hsa-miR-193a-5p	CLIP-seq
MIRT2553990	hsa-miR-2355-5p	CLIP-seq
MIRT2553991	hsa-miR-27a	CLIP-seq
MIRT2553992	hsa-miR-27b	CLIP-seq
MIRT2018563	hsa-miR-3158-5p	CLIP-seq
MIRT2018565	hsa-miR-320e	CLIP-seq
MIRT2553993	hsa-miR-329	CLIP-seq
MIRT2250410	hsa-miR-338-3p	CLIP-seq
MIRT1074955	hsa-miR-4308	CLIP-seq
MIRT2018576	hsa-miR-4474-3p	CLIP-seq
MIRT2018578	hsa-miR-4527	CLIP-seq
MIRT2250416	hsa-miR-4530	CLIP-seq
MIRT2553994	hsa-miR-4639-3p	CLIP-seq
MIRT2018581	hsa-miR-4687-3p	CLIP-seq
MIRT2018589	hsa-miR-4764-5p	CLIP-seq
MIRT2553995	hsa-miR-503	CLIP-seq
MIRT2553996	hsa-miR-512-3p	CLIP-seq
MIRT1074973	hsa-miR-642b	CLIP-seq
MIRT2553997	hsa-miR-668	CLIP-seq
MIRT2553998	hsa-miR-670	CLIP-seq
MIRT2683020	hsa-miR-4426	CLIP-seq
MIRT2683021	hsa-miR-4647	CLIP-seq
MIRT2683022	hsa-miR-4662b	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12747803
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12747803
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008440	Function	Inositol-1,4,5-trisphosphate 3-kinase activity	IDA	11085927, 12747803
GO:0008440	Function	Inositol-1,4,5-trisphosphate 3-kinase activity	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0032958	Process	Inositol phosphate biosynthetic process	IBA
GO:0032958	Process	Inositol phosphate biosynthetic process	IEA
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IBA
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IDA	11085927, 12747803
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IEA
GO:0071277	Process	Cellular response to calcium ion	IDA	12747803
GO:0071277	Process	Cellular response to calcium ion	IEA

MIM	HGNC	e!Ensembl
606476	14897	ENSG00000086544

Q96DU7

Protein name

Inositol-trisphosphate 3-kinase C (EC 2.7.1.127) (Inositol 1,4,5-trisphosphate 3-kinase C) (IP3 3-kinase C) (IP3K C) (InsP 3-kinase C)

Protein function

Catalyzes the phosphorylation of 1D-myo-inositol 1,4,5-trisphosphate (InsP3) into 1D-myo-inositol 1,3,4,5-tetrakisphosphate and participates to the regulation of calcium homeostasis (PubMed:11085927, PubMed:12747803). Can phosphorylate inositol

PDB

2A98

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03770	IPK	467 → 678	Inositol polyphosphate kinase	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in pancreas, skeletal muscle, liver, placenta and weakly in kidney and brain. {ECO:0000269|PubMed:11085927}.

Sequence

MRRCPCRGSLNEAEAGALPAAARMGLEAPRGGRRRQPGQQRPGPGAGAPAGRPEGGGPWA
RTEGSSLHSEPERAGLGPAPGTESPQAEFWTDGQTEPAAAGLGVETERPKQKTEPDRSSL
RTHLEWSWSELETTCLWTETGTDGLWTDPHRSDLQFQPEEASPWTQPGVHGPWTELETHG
SQTQPERVKSWADNLWTHQNSSSLQTHPEGACPSKEPSADGSWKELYTDGSRTQQDIEGP
WTEPYTDGSQKKQDTEAARKQPGTGGFQIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPED
GPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSA
SSFDESEDDVVAGGGGASDPEDRSGSKPWKKLKTVLKYSPFVVSFRKHYPWVQLSGHAGN
FQAGEDGRILKRFCQCEQRSLEQLMKDPLRPFVPAYYGMVLQDGQTFNQMEDLLADFEGP
SIMDCKMGSRTYLEEELVKARERPRPRKDMYEKMVAVDPGAPTPEEHAQGAVTKPRYMQW
RETMSSTSTLGFRIEGIKKADGTCNTNFKKTQALEQVTKVLEDFVDGDHVILQKYVACLE
ELREALEISPFFKTHEVVGSSLLFVHDHTGLAKVWMIDFGKTVALPDHQTLSHRLPWAEG
NREDGYLWGLDNMICLLQGLAQS

Sequence length

683

Interactions

View interactions

	KEGG		Reactome
	Inositol phosphate metabolism Metabolic pathways Calcium signaling pathway Phosphatidylinositol signaling system		Synthesis of IP3 and IP4 in the cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ANEURYSM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ITPKC-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Reclassified - variant of unknown significance	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bone Diseases Metabolic	Bone disease	Pubtator	30355649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22610085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22610085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22610085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	18084290		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Aneurysm	Coronary Aneurysm	CTD_human_DG	18084290		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Aneurysm	Coronary aneurysm	Pubtator	18084290, 37404818	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	18084290, 23894522, 24621571, 29214786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	28664405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	24800221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	24800221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24800221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22610085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	18084290, 19158812, 20045869, 20616737, 20690826, 20805785, 21487896, 21533171, 21987091, 22361738, 23065250, 23894522, 24621571, 28656474, 29604968		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	LHGDN	18084290		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	CTD_human_DG	18084290		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	18084290, 21533171, 23747857, 23894522, 24621571, 29214786, 33772158, 37404818	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASDB_DG	22081228		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASCAT_DG	22081228		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	BEFREE	24800221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	24800221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	37404818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22610085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ITPKC (inositol-trisphosphate 3-kinase C)