Gene Gene information from NCBI Gene database.
Entrez ID 8027
Gene name Signal transducing adaptor molecule
Gene symbol STAM
Synonyms (NCBI Gene)
STAM-1STAM1
Chromosome 10
Chromosome location 10p12.33
Summary This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded pr
miRNA miRNA information provided by mirtarbase database.
238
miRTarBase ID miRNA Experiments Reference
MIRT024512 hsa-miR-215-5p Microarray 19074876
MIRT026819 hsa-miR-192-5p Microarray 19074876
MIRT051525 hsa-let-7e-5p CLASH 23622248
MIRT707233 hsa-miR-3617-5p HITS-CLIP 21572407
MIRT707232 hsa-miR-641 HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10383417, 16189514, 16730941, 17078930, 17235283, 19111546, 19278655, 20150893, 24790097, 29892012, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005737 Component Cytoplasm IEA
GO:0005768 Component Endosome IEA
GO:0005829 Component Cytosol IDA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601899 11357 ENSG00000136738
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92783
Protein name Signal transducing adapter molecule 1 (STAM-1)
Protein function Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involv
PDB 2L0A , 3F1I , 3LDZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00790 VHS 5 139 VHS domain Domain
PF02809 UIM 171 187 Ubiquitin interaction motif Motif
PF00018 SH3_1 216 261 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:8780729}.
Sequence
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQG
VTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQ
RQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPS
NFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPAATAAAATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
Sequence length 540
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocytosis
JAK-STAT signaling pathway
  EGFR downregulation
Metalloprotease DUBs
Negative regulation of MET activity
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Endosomal Sorting Complex Required For Transport (ESCRT)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Colorectal cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autism Spectrum Disorder Autism Pubtator 28281572 Associate
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 28281572
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 38049741 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Diabetes Diabetes BEFREE 28730823
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes Mellitus BEFREE 28730823
★☆☆☆☆
Found in Text Mining only
Fatty Liver Fatty Liver BEFREE 25117675, 31155606
★☆☆☆☆
Found in Text Mining only
Fatty Liver Disease Fatty Liver BEFREE 25117675, 28218651, 28730823, 29847555, 30467325, 30850637, 31155606
★☆☆☆☆
Found in Text Mining only
Fibrosis, Liver Liver Fibrosis BEFREE 31717385
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma Pubtator 32065482 Associate
★☆☆☆☆
Found in Text Mining only