Gene Gene information from NCBI Gene database.
Entrez ID 80254
Gene name Centrosomal protein 63
Gene symbol CEP63
Synonyms (NCBI Gene)
SCKL6
Chromosome 3
Chromosome location 3q22.2
Summary This gene encodes a protein with six coiled-coil domains. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. Several alternatively spliced transcript variants
SNPs SNP information provided by dbSNP.
6
SNP ID Visualize variation Clinical significance Consequence
rs142766824 C>G,T Conflicting-interpretations-of-pathogenicity Missense variant, non coding transcript variant, coding sequence variant
rs746387482 ->TTAA Likely-pathogenic 5 prime UTR variant, coding sequence variant, non coding transcript variant, inframe indel, stop gained
rs752207334 G>A,T Pathogenic Splice acceptor variant
rs763001827 C>T Pathogenic, uncertain-significance Non coding transcript variant, missense variant, coding sequence variant, 5 prime UTR variant, stop gained
rs1164567042 G>A,T Pathogenic 5 prime UTR variant, coding sequence variant, non coding transcript variant, stop gained, missense variant
miRNA miRNA information provided by mirtarbase database.
224
miRTarBase ID miRNA Experiments Reference
MIRT000831 hsa-miR-15a-5p Microarray 18362358
MIRT000830 hsa-miR-16-5p Microarray 18362358
MIRT659578 hsa-miR-585-5p HITS-CLIP 23824327
MIRT659577 hsa-miR-5682 HITS-CLIP 23824327
MIRT659576 hsa-miR-374b-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000077 Process DNA damage checkpoint signaling ISS
GO:0000922 Component Spindle pole ISS
GO:0005515 Function Protein binding IPI 12812986, 17043677, 20360068, 21516116, 22458338, 24240477, 25416956, 25910212, 26297806, 26496610, 26638075, 26871637, 27107012, 30021884, 31413325, 31515488, 32296183, 32402286, 32814053, 33961781, 35709258
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614724 25815 ENSG00000182923
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96MT8
Protein name Centrosomal protein of 63 kDa (Cep63)
Protein function Required for normal spindle assembly (PubMed:21406398, PubMed:21983783, PubMed:26297806, PubMed:35793002). Plays a key role in mother-centriole-dependent centriole duplication; the function seems also to involve CEP152, CDK5RAP2 and WDR62 throug
PDB 6CSU , 6CSV , 7W91
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17045 CEP63 18 280 Centrosomal protein of 63 kDa Coiled-coil
Sequence
MEALLEGIQNRGHGGGFLTSCEAELQELMKQIDIMVAHKKSEWEGRTHALETCLKIREQE
LKSLRSQLDVTHKEVGMLHQQVEEHEKIKQEMTMEYKQELKKLHEELCILKRSYEKLQKK
QMREFRGNTKNHREDRSEIERLTAKIEEFRQKSLDWEKQRLIYQQQVSSLEAQRKALAEQ
SEIIQAQLVNRKQKLESVELSSQSEIQHLSSKLERANDTICANELEIERLTMRVNDLVGT
SMTVLQEQQQKEEKLRESEKLLEALQEEKRELKAALQSQE
NLIHEARIQKEKLQEKVKAT
NTQHAVEAIRPREESLAEKKYTSQGQGDLDSVLSQLNFTHTSEDLLQAEVTCLEGSLESV
SATCKQLSQELMEKYEELKRMEAHNNEYKAEIKKLKEQILQGEQSYSSALEGMKMEISHL
TQELHQRDITIASTKGSSSDMEKRLRAEMQKAEDKAVEHKEILDQLESLKLENRHLSEMV
MKLELGLHEAKEISLADLQENYIEALNKLVSENQQLQKDLMNTKSQLEISTQMCKKQNDR
IFKPTHSRTTEFKNTEFKPTHGQHRHDGIKTEHYKTDLHSPRGQASDSINPMSRVLSPLS
PQISPCSSTRSLTSYSLCKTHSLPSALDTNEANFSDTMSESMNDQEEFISSCSLPVSPLG
SIATRFLEEEELRSHHILERLDAHIEELKRESEKTVRQFTALK
Sequence length 703
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
32
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Papillary renal cell carcinoma type 1 Likely pathogenic rs150764448 RCV005925633
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Seckel syndrome 6 Likely pathogenic; Pathogenic rs753579827, rs2109591981, rs746387482, rs2547181177, rs2546848928, rs1164567042, rs773725359 RCV001449971
RCV001449972
RCV000490311
RCV003129590
RCV003332017
View all (2 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE PRIMARY MICROCEPHALY Disgenet, GenCC
Disgenet, GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CEP63-related disorder Uncertain significance; Likely benign; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Agenesis of corpus callosum Agenesis Of Corpus Callosum HPO_DG
★☆☆☆☆
Found in Text Mining only
Autosomal Recessive Primary Microcephaly Microcephaly BEFREE 21983783
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal Recessive Primary Microcephaly Primary microcephaly Pubtator 21983783, 26297806, 34068194 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal Recessive Primary Microcephaly Microcephaly ORPHANET_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Autosomal recessive primary microcephaly Microcephaly Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Developmental reading disorder Developmental dyslexia BEFREE 26400686
★☆☆☆☆
Found in Text Mining only
Developmental reading disorder Developmental dyslexia GENOMICS_ENGLAND_DG 26400686
★☆☆☆☆
Found in Text Mining only
Dwarfism Dwarfism HPO_DG
★☆☆☆☆
Found in Text Mining only
Dyslexia Dyslexia Pubtator 26400686 Associate
★☆☆☆☆
Found in Text Mining only
Dysmorphic features Dysmorphic Features CLINVAR_DG 15284851, 15793586, 16829198, 19344873, 19348700, 19829375, 19854944, 20598275, 21406398, 21983783, 22775483, 23936128, 25348405, 26158450, 26400686
★☆☆☆☆
Found in Text Mining only