Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80212
Gene name	Coiled-coil domain containing 92
Gene symbol	CCDC92
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q24.31

112

Show/Hide all (112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019475	hsa-miR-148b-3p	Microarray	17612493
MIRT870445	hsa-miR-1250	CLIP-seq
MIRT870446	hsa-miR-2277-3p	CLIP-seq
MIRT870447	hsa-miR-2277-5p	CLIP-seq
MIRT870448	hsa-miR-3120-3p	CLIP-seq
MIRT870449	hsa-miR-3151	CLIP-seq
MIRT870450	hsa-miR-3153	CLIP-seq
MIRT870451	hsa-miR-3177-3p	CLIP-seq
MIRT870452	hsa-miR-3185	CLIP-seq
MIRT870453	hsa-miR-3187-3p	CLIP-seq
MIRT870454	hsa-miR-3611	CLIP-seq
MIRT870455	hsa-miR-3616-3p	CLIP-seq
MIRT870456	hsa-miR-3650	CLIP-seq
MIRT870457	hsa-miR-3689d	CLIP-seq
MIRT870458	hsa-miR-3925-3p	CLIP-seq
MIRT870459	hsa-miR-3974	CLIP-seq
MIRT870460	hsa-miR-423-3p	CLIP-seq
MIRT870461	hsa-miR-4292	CLIP-seq
MIRT870462	hsa-miR-4433	CLIP-seq
MIRT870463	hsa-miR-4435	CLIP-seq
MIRT870464	hsa-miR-4459	CLIP-seq
MIRT870465	hsa-miR-4496	CLIP-seq
MIRT870466	hsa-miR-4520a-3p	CLIP-seq
MIRT870467	hsa-miR-4632	CLIP-seq
MIRT870468	hsa-miR-4646-5p	CLIP-seq
MIRT870469	hsa-miR-4651	CLIP-seq
MIRT870470	hsa-miR-4668-5p	CLIP-seq
MIRT870471	hsa-miR-4701-5p	CLIP-seq
MIRT870472	hsa-miR-4761-5p	CLIP-seq
MIRT870473	hsa-miR-4768-3p	CLIP-seq
MIRT870474	hsa-miR-486-3p	CLIP-seq
MIRT870475	hsa-miR-502-5p	CLIP-seq
MIRT870476	hsa-miR-542-3p	CLIP-seq
MIRT870477	hsa-miR-548s	CLIP-seq
MIRT870478	hsa-miR-564	CLIP-seq
MIRT870479	hsa-miR-588	CLIP-seq
MIRT870480	hsa-miR-608	CLIP-seq
MIRT870481	hsa-miR-665	CLIP-seq
MIRT870482	hsa-miR-765	CLIP-seq
MIRT870483	hsa-miR-766	CLIP-seq
MIRT1958399	hsa-miR-146b-3p	CLIP-seq
MIRT1958400	hsa-miR-181a	CLIP-seq
MIRT1958401	hsa-miR-181b	CLIP-seq
MIRT1958402	hsa-miR-181c	CLIP-seq
MIRT1958403	hsa-miR-181d	CLIP-seq
MIRT1958404	hsa-miR-3173-5p	CLIP-seq
MIRT1958405	hsa-miR-3907	CLIP-seq
MIRT870460	hsa-miR-423-3p	CLIP-seq
MIRT1958406	hsa-miR-4254	CLIP-seq
MIRT1958407	hsa-miR-4262	CLIP-seq
MIRT1958408	hsa-miR-4308	CLIP-seq
MIRT1958409	hsa-miR-4689	CLIP-seq
MIRT1958410	hsa-miR-4755-3p	CLIP-seq
MIRT1958411	hsa-miR-580	CLIP-seq
MIRT1958412	hsa-miR-874	CLIP-seq
MIRT2195243	hsa-miR-1178	CLIP-seq
MIRT2195244	hsa-miR-1207-5p	CLIP-seq
MIRT2195245	hsa-miR-1279	CLIP-seq
MIRT2195246	hsa-miR-128	CLIP-seq
MIRT2195247	hsa-miR-148a	CLIP-seq
MIRT2195248	hsa-miR-148b	CLIP-seq
MIRT2195249	hsa-miR-152	CLIP-seq
MIRT1958400	hsa-miR-181a	CLIP-seq
MIRT1958401	hsa-miR-181b	CLIP-seq
MIRT1958402	hsa-miR-181c	CLIP-seq
MIRT1958403	hsa-miR-181d	CLIP-seq
MIRT2195250	hsa-miR-27a	CLIP-seq
MIRT2195251	hsa-miR-27b	CLIP-seq
MIRT2195252	hsa-miR-28-5p	CLIP-seq
MIRT2195253	hsa-miR-31	CLIP-seq
MIRT870448	hsa-miR-3120-3p	CLIP-seq
MIRT2195254	hsa-miR-3139	CLIP-seq
MIRT2195255	hsa-miR-3150b-3p	CLIP-seq
MIRT870452	hsa-miR-3185	CLIP-seq
MIRT870453	hsa-miR-3187-3p	CLIP-seq
MIRT870454	hsa-miR-3611	CLIP-seq
MIRT870455	hsa-miR-3616-3p	CLIP-seq
MIRT870456	hsa-miR-3650	CLIP-seq
MIRT870457	hsa-miR-3689d	CLIP-seq
MIRT2195256	hsa-miR-383	CLIP-seq
MIRT1958405	hsa-miR-3907	CLIP-seq
MIRT870458	hsa-miR-3925-3p	CLIP-seq
MIRT1958407	hsa-miR-4262	CLIP-seq
MIRT870463	hsa-miR-4435	CLIP-seq
MIRT870464	hsa-miR-4459	CLIP-seq
MIRT870465	hsa-miR-4496	CLIP-seq
MIRT2195257	hsa-miR-4504	CLIP-seq
MIRT2195258	hsa-miR-4517	CLIP-seq
MIRT1958409	hsa-miR-4689	CLIP-seq
MIRT870471	hsa-miR-4701-5p	CLIP-seq
MIRT2195259	hsa-miR-4734	CLIP-seq
MIRT2195260	hsa-miR-4763-3p	CLIP-seq
MIRT2195261	hsa-miR-4778-5p	CLIP-seq
MIRT2195262	hsa-miR-4784	CLIP-seq
MIRT870476	hsa-miR-542-3p	CLIP-seq
MIRT870477	hsa-miR-548s	CLIP-seq
MIRT870479	hsa-miR-588	CLIP-seq
MIRT870481	hsa-miR-665	CLIP-seq
MIRT2195263	hsa-miR-708	CLIP-seq
MIRT870482	hsa-miR-765	CLIP-seq
MIRT870483	hsa-miR-766	CLIP-seq
MIRT2498517	hsa-miR-1182	CLIP-seq
MIRT2498518	hsa-miR-1909	CLIP-seq
MIRT870458	hsa-miR-3925-3p	CLIP-seq
MIRT870460	hsa-miR-423-3p	CLIP-seq
MIRT2498519	hsa-miR-4419a	CLIP-seq
MIRT870464	hsa-miR-4459	CLIP-seq
MIRT2498520	hsa-miR-4510	CLIP-seq
MIRT1958410	hsa-miR-4755-3p	CLIP-seq
MIRT2498521	hsa-miR-4779	CLIP-seq
MIRT870481	hsa-miR-665	CLIP-seq
MIRT870483	hsa-miR-766	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	22458338, 22863007, 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005814	Component	Centriole	IBA
GO:0005814	Component	Centriole	IDA	22863007
GO:0005814	Component	Centriole	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0045087	Process	Innate immune response	IEA
GO:0050688	Process	Regulation of defense response to virus	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q53HC0

Protein name

Coiled-coil domain-containing protein 92 (Limkain beta-2)

Protein function

Interferon-stimulated protein that plays a role in innate immunity. Strongly inhibits ebolavirus transcription and replication. Forms a complex with viral RNA-bound nucleocapsid NP and thereby prevents the transport of NP to the cell surface. {E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14916	CCDC92	24 → 80	Coiled-coil domain of unknown function	Coiled-coil

Sequence

MTSPHFSSYDEGPLDVSMAATNLENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCT
DLTYELTVKSSEQTGDGTSKSSELKKRCEELEAQLKVKENENAELLKELEQKNAMITVLE
NTIKEREKKYLEELKAKSHKLTLLSSELEQRASTIAYLTSQLHAAKKKLMSSSGTSDASP
SGSPVLASYKPAPPKDKLPETPRRRMKKSLSAPLHPEFEEVYRFGAESRKLLLREPVDAM
PDPTPFLLARESAEVHLIKERPLVIPPIASDRSGEQHSPAREKPHKAHVGVAHRIHHATP
PQAQPEVKTLAVDQVNGGKVVRKHSGTDRTV

Sequence length

331

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35785618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28714974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28714974		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714974, 29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	28714974	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	28869590, 29439709	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	28714974, 28869590, 29439709		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	CTD_human_DG	28869590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28869590, 37540242	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28869590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	28869590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hashimoto Disease	Hashimoto disease	Pubtator	36674671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	29439709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28714974, 29439709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34129933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CCDC92 (coiled-coil domain containing 92)