Gene Gene information from NCBI Gene database.
Entrez ID 80149
Gene name Zinc finger CCCH-type containing 12A
Gene symbol ZC3H12A
Synonyms (NCBI Gene)
MCPIPMCPIP-1MCPIP1Reg1dJ423B22.1
Chromosome 1
Chromosome location 1p34.3
Summary ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
72
miRTarBase ID miRNA Experiments Reference
MIRT018752 hsa-miR-335-5p Microarray 18185580
MIRT443288 hsa-miR-4753-5p PAR-CLIP 22100165
MIRT443287 hsa-miR-6858-3p PAR-CLIP 22100165
MIRT443286 hsa-miR-4676-5p PAR-CLIP 22100165
MIRT443285 hsa-miR-575 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
139
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18178554
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay ISS
GO:0000932 Component P-body IDA 22055188, 26134560
GO:0000932 Component P-body IEA
GO:0001525 Process Angiogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610562 26259 ENSG00000163874
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5D1E8
Protein name Endoribonuclease ZC3H12A (EC 3.1.-.-) (Monocyte chemotactic protein-induced protein 1) (MCP-induced protein 1) (MCPIP-1) (Regnase-1) (Reg1) (Zinc finger CCCH domain-containing protein 12A)
Protein function Endoribonuclease involved in various biological functions such as cellular inflammatory response and immune homeostasis, glial differentiation of neuroprogenitor cells, cell death of cardiomyocytes, adipogenesis and angiogenesis. Functions as an
PDB 3V32 , 3V33 , 3V34
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18039 UBA_6 48 89 UBA-like domain Domain
PF11977 RNase_Zc3h12a 134 290 Zc3h12a-like Ribonuclease NYN domain Domain
PF18561 Regnase_1_C 549 593 Endoribonuclease Regnase 1/ ZC3H12 C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, placenta, spleen, kidney, liver and lung (PubMed:19909337). Expressed in leukocytes (PubMed:19909337). Expressed in monocyte (PubMed:16574901). {ECO:0000269|PubMed:16574901, ECO:0000269|PubMed:19909337}.
Sequence
MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGY
SSTEIHSVLQKLGVQADTNTVLGELVKHG
TATERERQTSPDPCPQLPLVPRGGGTPKAPN
LEPPLPEEEKEGSDLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVP
SWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAYESDGIV
VSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDN
FLRKKPLTLE
HRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSP
SSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPA
TAAFSAFGRAMGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGR
SPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE
Sequence length 599
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ARTERIAL OCCLUSIVE DISEASES CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEPATITIS B Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Anaplasia Anaplasia BEFREE 15211106
★☆☆☆☆
Found in Text Mining only
Anemia Anemia BEFREE 19322177
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm, Abdominal Aortic Aneurysm BEFREE 31651935
★☆☆☆☆
Found in Text Mining only
Arterial Occlusive Diseases Arterial Occlusive Disease CTD_human_DG 22196138
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Asthma Asthma BEFREE 29111212
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 20807520, 28194024, 29777912, 31718798
★☆☆☆☆
Found in Text Mining only
Brain Ischemia Cerebral Ischemia BEFREE 22196138
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 25187114, 26833120, 31718519
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 36138026 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 39273406 Associate
★☆☆☆☆
Found in Text Mining only