Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80142
Gene name	Prostaglandin E synthase 2
Gene symbol	PTGES2
Synonyms (NCBI Gene)	C9orf15GBF-1GBF1PGES2mPGES-2
Chromosome	9
Chromosome location	9q34.11
Summary	The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-acti

112

Show/Hide all (112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016466	hsa-miR-193b-3p	Proteomics	21512034
MIRT028318	hsa-miR-32-5p	Sequencing	20371350
MIRT052529	hsa-let-7a-5p	CLASH	23622248
MIRT052205	hsa-let-7b-5p	CLASH	23622248
MIRT051829	hsa-let-7c-5p	CLASH	23622248
MIRT437844	hsa-miR-146a-5p	Luciferase reporter assay	23589616
MIRT470084	hsa-miR-137	PAR-CLIP	23592263
MIRT470083	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT470082	hsa-miR-6834-3p	PAR-CLIP	23592263
MIRT470081	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028318	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT470080	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT470079	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT470078	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT470077	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT107246	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT470076	hsa-miR-4532	PAR-CLIP	23592263
MIRT470075	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT470074	hsa-miR-3188	PAR-CLIP	23592263
MIRT470073	hsa-miR-4481	PAR-CLIP	23592263
MIRT470072	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT470071	hsa-miR-1292-5p	PAR-CLIP	23592263
MIRT470070	hsa-miR-4471	PAR-CLIP	23592263
MIRT470069	hsa-miR-8059	PAR-CLIP	23592263
MIRT470068	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT470067	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT470066	hsa-miR-4433a-5p	PAR-CLIP	23592263
MIRT470065	hsa-miR-4449	PAR-CLIP	23592263
MIRT470064	hsa-miR-548aw	PAR-CLIP	23592263
MIRT470063	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT470062	hsa-miR-527	PAR-CLIP	23592263
MIRT470061	hsa-miR-4433b-5p	PAR-CLIP	23592263
MIRT470060	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT470084	hsa-miR-137	PAR-CLIP	23592263
MIRT470083	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT470082	hsa-miR-6834-3p	PAR-CLIP	23592263
MIRT470081	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028318	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT470080	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT470079	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT470078	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT470077	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT107246	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT470076	hsa-miR-4532	PAR-CLIP	23592263
MIRT470075	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT470074	hsa-miR-3188	PAR-CLIP	23592263
MIRT470073	hsa-miR-4481	PAR-CLIP	23592263
MIRT470072	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT470071	hsa-miR-1292-5p	PAR-CLIP	23592263
MIRT470070	hsa-miR-4471	PAR-CLIP	23592263
MIRT470069	hsa-miR-8059	PAR-CLIP	23592263
MIRT470068	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT470067	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT470066	hsa-miR-4433a-5p	PAR-CLIP	23592263
MIRT470065	hsa-miR-4449	PAR-CLIP	23592263
MIRT470064	hsa-miR-548aw	PAR-CLIP	23592263
MIRT470063	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT470062	hsa-miR-527	PAR-CLIP	23592263
MIRT470061	hsa-miR-4433b-5p	PAR-CLIP	23592263
MIRT470060	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT1272675	hsa-miR-1292	CLIP-seq
MIRT1272676	hsa-miR-1537	CLIP-seq
MIRT1272677	hsa-miR-25	CLIP-seq
MIRT1272678	hsa-miR-32	CLIP-seq
MIRT1272679	hsa-miR-363	CLIP-seq
MIRT1272680	hsa-miR-367	CLIP-seq
MIRT1272681	hsa-miR-370	CLIP-seq
MIRT1272682	hsa-miR-4421	CLIP-seq
MIRT1272683	hsa-miR-495	CLIP-seq
MIRT1272684	hsa-miR-626	CLIP-seq
MIRT1272685	hsa-miR-92a	CLIP-seq
MIRT1272686	hsa-miR-92b	CLIP-seq
MIRT2080184	hsa-miR-3677-5p	CLIP-seq
MIRT2080185	hsa-miR-663b	CLIP-seq
MIRT2306460	hsa-miR-1265	CLIP-seq
MIRT1272675	hsa-miR-1292	CLIP-seq
MIRT2306461	hsa-miR-1302	CLIP-seq
MIRT2306462	hsa-miR-1915	CLIP-seq
MIRT1272677	hsa-miR-25	CLIP-seq
MIRT2306463	hsa-miR-3180	CLIP-seq
MIRT2306464	hsa-miR-3180-3p	CLIP-seq
MIRT2306465	hsa-miR-3184	CLIP-seq
MIRT2306466	hsa-miR-3196	CLIP-seq
MIRT1272678	hsa-miR-32	CLIP-seq
MIRT2306467	hsa-miR-34a	CLIP-seq
MIRT2306468	hsa-miR-34c-5p	CLIP-seq
MIRT1272679	hsa-miR-363	CLIP-seq
MIRT2306469	hsa-miR-3652	CLIP-seq
MIRT1272680	hsa-miR-367	CLIP-seq
MIRT2306470	hsa-miR-423-5p	CLIP-seq
MIRT2306471	hsa-miR-4252	CLIP-seq
MIRT2306472	hsa-miR-4298	CLIP-seq
MIRT2306473	hsa-miR-4430	CLIP-seq
MIRT2306474	hsa-miR-4436b-3p	CLIP-seq
MIRT2306475	hsa-miR-4446-3p	CLIP-seq
MIRT2306476	hsa-miR-4492	CLIP-seq
MIRT2306477	hsa-miR-4498	CLIP-seq
MIRT2306478	hsa-miR-449a	CLIP-seq
MIRT2306479	hsa-miR-449b	CLIP-seq
MIRT2306480	hsa-miR-4691-3p	CLIP-seq
MIRT2306481	hsa-miR-4736	CLIP-seq
MIRT2306482	hsa-miR-665	CLIP-seq
MIRT2306483	hsa-miR-762	CLIP-seq
MIRT1272685	hsa-miR-92a	CLIP-seq
MIRT1272686	hsa-miR-92b	CLIP-seq
MIRT2393181	hsa-miR-2278	CLIP-seq
MIRT1272677	hsa-miR-25	CLIP-seq
MIRT1272678	hsa-miR-32	CLIP-seq
MIRT1272679	hsa-miR-363	CLIP-seq
MIRT1272680	hsa-miR-367	CLIP-seq
MIRT1272685	hsa-miR-92a	CLIP-seq
MIRT1272686	hsa-miR-92b	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	12835322
GO:0000139	Component	Golgi membrane	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32353859, 33060197, 36217030
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	12835322
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IDA	17585783
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IDA	17585783
GO:0016829	Function	Lyase activity	IEA
GO:0016829	Function	Lyase activity	ISS
GO:0016853	Function	Isomerase activity	IEA
GO:0020037	Function	Heme binding	ISS
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0036134	Function	12-hydroxyheptadecatrienoic acid synthase activity	IEA
GO:0043295	Function	Glutathione binding	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046457	Process	Prostanoid biosynthetic process	IEA
GO:0046457	Process	Prostanoid biosynthetic process	TAS
GO:0046903	Process	Secretion	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050220	Function	Prostaglandin-E synthase activity	EXP	10922363
GO:0050220	Function	Prostaglandin-E synthase activity	IBA
GO:0050220	Function	Prostaglandin-E synthase activity	IDA	12804604
GO:0050220	Function	Prostaglandin-E synthase activity	IEA

MIM	HGNC	e!Ensembl
608152	17822	ENSG00000148334

Q9H7Z7

Protein name

Prostaglandin E synthase 2 (EC 5.3.99.3) (Membrane-associated prostaglandin E synthase-2) (mPGE synthase-2) (Microsomal prostaglandin E synthase 2) (mPGES-2) (Prostaglandin-H(2) E-isomerase) [Cleaved into: Prostaglandin E synthase 2 truncated form]

Protein function

Isomerase that catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2) (in vitro) (PubMed:12804604, PubMed:17585783, PubMed:18198127). The biological function and the GSH-dependent property of PTGES2 is still under debate (

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13417	GST_N_3	104 → 174	Glutathione S-transferase, N-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, fronta

Sequence

MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH

Sequence length

377

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways		Synthesis of Prostaglandins (PG) and Thromboxanes (TX) Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	21589857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19664621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	40269781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	34224495	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19412621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16495511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	30794864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	39766823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17566096, 17979097, 19268562, 19371221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	30901811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27230680, 30214592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21589857, 27230680	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24035605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	15531909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17641732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28860615, 30442945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27230680, 30214592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21308720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17979097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17979097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15225371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30794864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASCAT_DG	28892059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21435451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	24467603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21308720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21308720	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26736064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29636881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	16823844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	22387750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	22387750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	22387750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	24035605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	31947646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PTGES2 (prostaglandin E synthase 2)