Gene Gene information from NCBI Gene database.
Entrez ID 80139
Gene name Zinc finger protein 703
Gene symbol ZNF703
Synonyms (NCBI Gene)
NLZ1ZEPPO1ZNF503LZPO1
Chromosome 8
Chromosome location 8p11.23
miRNA miRNA information provided by mirtarbase database.
1119
miRTarBase ID miRNA Experiments Reference
MIRT050650 hsa-miR-18a-5p CLASH 23622248
MIRT050098 hsa-miR-26a-5p CLASH 23622248
MIRT049534 hsa-miR-92a-3p CLASH 23622248
MIRT049534 hsa-miR-92a-3p CLASH 23622248
MIRT042430 hsa-miR-425-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21328542, 28514442, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 21328542, 21337521
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 21328542
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617045 25883 ENSG00000183779
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H7S9
Protein name Zinc finger protein 703 (Zinc finger elbow-related proline domain protein 1)
Protein function Transcriptional corepressor which does not bind directly to DNA and may regulate transcription through recruitment of histone deacetylases to gene promoters. Regulates cell adhesion, migration and proliferation. May be required for segmental gen
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12402 nlz1 311 365 NocA-like zinc-finger protein 1 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in mammary epithelium. {ECO:0000269|PubMed:21317240}.
Sequence
MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHT
GHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGL
GAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSS
SSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGG
ELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYK
PGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSS
SPLTG
ASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPG
HPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSH
LRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTL
GLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ
Sequence length 590
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 21317240, 23991038, 24481460, 26805938, 29176314, 31195426
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 21328542, 22747683, 23991038, 24156016, 25742952, 30252041, 35236318, 35590107 Associate
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma BEFREE 27764785
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 25017610
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 37821882 Associate
★☆☆☆☆
Found in Text Mining only
Congenital contractural arachnodactyly Congenital Contractural Arachnodactyly BEFREE 27764785
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Esophageal squamous cell carcinoma Pubtator 27453415 Associate
★☆☆☆☆
Found in Text Mining only
Glioma Glioma Pubtator 32271436 Associate
★☆☆☆☆
Found in Text Mining only
Head and Neck Carcinoma Head And Neck Carcinoma BEFREE 31574205
★☆☆☆☆
Found in Text Mining only
Laryngeal Neoplasms Laryngeal neoplasm Pubtator 26063961 Stimulate
★☆☆☆☆
Found in Text Mining only