NR4A3 (nuclear receptor subfamily 4 group A member 3)

Gene

• Entrez ID: 8013
• Gene name: Nuclear receptor subfamily 4 group A member 3
• Gene symbol: NR4A3
• Synonyms (NCBI Gene): CHN, CSMF, MINOR, NOR1
• Chromosome: 9
• Chromosome location: 9q31.1
• Summary: This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskel

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022644	hsa-miR-124-3p	Microarray	18668037
MIRT025586	hsa-miR-10b-5p	Reporter assay	21642433
MIRT029401	hsa-miR-26b-5p	Microarray	19088304
MIRT701365	hsa-miR-654-3p	HITS-CLIP	23313552
MIRT701364	hsa-miR-6828-5p	HITS-CLIP	23313552
MIRT701363	hsa-miR-671-5p	HITS-CLIP	23313552
MIRT701362	hsa-miR-2052	HITS-CLIP	23313552
MIRT701361	hsa-miR-19a-5p	HITS-CLIP	23313552
MIRT701360	hsa-miR-19b-1-5p	HITS-CLIP	23313552
MIRT701359	hsa-miR-19b-2-5p	HITS-CLIP	23313552
MIRT701358	hsa-miR-5701	HITS-CLIP	23313552
MIRT701357	hsa-miR-5590-5p	HITS-CLIP	23313552
MIRT701356	hsa-miR-4659a-5p	HITS-CLIP	23313552
MIRT701355	hsa-miR-4659b-5p	HITS-CLIP	23313552
MIRT701354	hsa-miR-6079	HITS-CLIP	23313552
MIRT701353	hsa-miR-4776-3p	HITS-CLIP	23313552
MIRT701352	hsa-miR-3154	HITS-CLIP	23313552
MIRT701350	hsa-miR-6819-3p	HITS-CLIP	23313552
MIRT701351	hsa-miR-6877-3p	HITS-CLIP	23313552
MIRT701349	hsa-miR-9500	HITS-CLIP	23313552
MIRT701348	hsa-miR-196b-3p	HITS-CLIP	23313552
MIRT701347	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT701346	hsa-miR-7515	HITS-CLIP	23313552
MIRT701345	hsa-miR-369-5p	HITS-CLIP	23313552
MIRT701344	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT701343	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT701342	hsa-miR-638	HITS-CLIP	23313552
MIRT701341	hsa-miR-4777-3p	HITS-CLIP	23313552
MIRT735916	hsa-miR-508-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	33942991
MIRT701365	hsa-miR-654-3p	HITS-CLIP	23313552
MIRT701364	hsa-miR-6828-5p	HITS-CLIP	23313552
MIRT701363	hsa-miR-671-5p	HITS-CLIP	23313552
MIRT701362	hsa-miR-2052	HITS-CLIP	23313552
MIRT701361	hsa-miR-19a-5p	HITS-CLIP	23313552
MIRT701360	hsa-miR-19b-1-5p	HITS-CLIP	23313552
MIRT701359	hsa-miR-19b-2-5p	HITS-CLIP	23313552
MIRT701358	hsa-miR-5701	HITS-CLIP	23313552
MIRT701357	hsa-miR-5590-5p	HITS-CLIP	23313552
MIRT701356	hsa-miR-4659a-5p	HITS-CLIP	23313552
MIRT701355	hsa-miR-4659b-5p	HITS-CLIP	23313552
MIRT701354	hsa-miR-6079	HITS-CLIP	23313552
MIRT701353	hsa-miR-4776-3p	HITS-CLIP	23313552
MIRT701352	hsa-miR-3154	HITS-CLIP	23313552
MIRT701350	hsa-miR-6819-3p	HITS-CLIP	23313552
MIRT701351	hsa-miR-6877-3p	HITS-CLIP	23313552
MIRT701349	hsa-miR-9500	HITS-CLIP	23313552
MIRT701348	hsa-miR-196b-3p	HITS-CLIP	23313552
MIRT701347	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT701346	hsa-miR-7515	HITS-CLIP	23313552
MIRT701345	hsa-miR-369-5p	HITS-CLIP	23313552
MIRT701344	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT701343	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT701342	hsa-miR-638	HITS-CLIP	23313552
MIRT701341	hsa-miR-4777-3p	HITS-CLIP	23313552
MIRT1192930	hsa-miR-1179	CLIP-seq
MIRT1192931	hsa-miR-1208	CLIP-seq
MIRT1192932	hsa-miR-1238	CLIP-seq
MIRT1192933	hsa-miR-1264	CLIP-seq
MIRT1192934	hsa-miR-140-3p	CLIP-seq
MIRT1192935	hsa-miR-224	CLIP-seq
MIRT1192936	hsa-miR-28-3p	CLIP-seq
MIRT1192937	hsa-miR-3074-5p	CLIP-seq
MIRT1192938	hsa-miR-3140-3p	CLIP-seq
MIRT1192939	hsa-miR-335	CLIP-seq
MIRT1192940	hsa-miR-3691-3p	CLIP-seq
MIRT1192941	hsa-miR-370	CLIP-seq
MIRT1192942	hsa-miR-3713	CLIP-seq
MIRT1192943	hsa-miR-374a	CLIP-seq
MIRT1192944	hsa-miR-374b	CLIP-seq
MIRT1192945	hsa-miR-4258	CLIP-seq
MIRT1192946	hsa-miR-4455	CLIP-seq
MIRT1192947	hsa-miR-4476	CLIP-seq
MIRT1192948	hsa-miR-4477b	CLIP-seq
MIRT1192949	hsa-miR-4502	CLIP-seq
MIRT1192950	hsa-miR-4533	CLIP-seq
MIRT1192951	hsa-miR-4731-5p	CLIP-seq
MIRT1192952	hsa-miR-548c-3p	CLIP-seq
MIRT1192953	hsa-miR-607	CLIP-seq
MIRT1192954	hsa-miR-609	CLIP-seq
MIRT1192930	hsa-miR-1179	CLIP-seq
MIRT1192931	hsa-miR-1208	CLIP-seq
MIRT1192935	hsa-miR-224	CLIP-seq
MIRT1192937	hsa-miR-3074-5p	CLIP-seq
MIRT1192955	hsa-miR-320a	CLIP-seq
MIRT1192956	hsa-miR-320b	CLIP-seq
MIRT1192957	hsa-miR-320c	CLIP-seq
MIRT1192958	hsa-miR-320d	CLIP-seq
MIRT1192959	hsa-miR-340	CLIP-seq
MIRT1192960	hsa-miR-3662	CLIP-seq
MIRT1192940	hsa-miR-3691-3p	CLIP-seq
MIRT1192941	hsa-miR-370	CLIP-seq
MIRT1192942	hsa-miR-3713	CLIP-seq
MIRT1192961	hsa-miR-380	CLIP-seq
MIRT1192962	hsa-miR-4429	CLIP-seq
MIRT1192947	hsa-miR-4476	CLIP-seq
MIRT1192948	hsa-miR-4477b	CLIP-seq
MIRT1192963	hsa-miR-4495	CLIP-seq
MIRT1192964	hsa-miR-4528	CLIP-seq
MIRT1192950	hsa-miR-4533	CLIP-seq
MIRT1192951	hsa-miR-4731-5p	CLIP-seq
MIRT1192965	hsa-miR-490-3p	CLIP-seq
MIRT1192966	hsa-miR-495	CLIP-seq
MIRT1192967	hsa-miR-548ae	CLIP-seq
MIRT1192968	hsa-miR-548aj	CLIP-seq
MIRT1192969	hsa-miR-548am	CLIP-seq
MIRT1192970	hsa-miR-548x	CLIP-seq
MIRT1192971	hsa-miR-642b	CLIP-seq
MIRT1192972	hsa-miR-649	CLIP-seq
MIRT2056022	hsa-miR-181a	CLIP-seq
MIRT2056023	hsa-miR-181b	CLIP-seq
MIRT2056024	hsa-miR-181c	CLIP-seq
MIRT2056025	hsa-miR-181d	CLIP-seq
MIRT2056026	hsa-miR-4262	CLIP-seq
MIRT1192965	hsa-miR-490-3p	CLIP-seq
MIRT1192972	hsa-miR-649	CLIP-seq
MIRT2284676	hsa-miR-144	CLIP-seq
MIRT2284677	hsa-miR-4263	CLIP-seq
MIRT2284678	hsa-miR-4735-5p	CLIP-seq
MIRT2284679	hsa-miR-501-3p	CLIP-seq
MIRT2284680	hsa-miR-502-3p	CLIP-seq
MIRT2284681	hsa-miR-576-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	10701778
TLX1	Activation	15384172

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001216	Function	DNA-binding transcription activator activity	IEA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	20558821
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	8634690
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	8570200
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	TAS	8570200
GO:0005515	Function	Protein binding	IPI	12543801, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8634690
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007369	Process	Gastrulation	IEA
GO:0007369	Process	Gastrulation	ISS
GO:0007411	Process	Axon guidance	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0010828	Process	Positive regulation of D-glucose transmembrane transport	IDA	24022864
GO:0019901	Function	Protein kinase binding	IPI	25852083
GO:0021766	Process	Hippocampus development	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0030534	Process	Adult behavior	IEA
GO:0032765	Process	Positive regulation of mast cell cytokine production	IEA
GO:0032765	Process	Positive regulation of mast cell cytokine production	ISS
GO:0034390	Process	Smooth muscle cell apoptotic process	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IEA
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IBA
GO:0035497	Function	CAMP response element binding	IEA
GO:0035497	Function	CAMP response element binding	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0035726	Process	Common myeloid progenitor cell proliferation	IEA
GO:0035726	Process	Common myeloid progenitor cell proliferation	ISS
GO:0038097	Process	Positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway	IEA
GO:0038097	Process	Positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway	ISS
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043303	Process	Mast cell degranulation	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0044320	Process	Cellular response to leptin stimulus	ISS
GO:0045333	Process	Cellular respiration	IEA
GO:0045333	Process	Cellular respiration	ISS
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20558821
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IDA	23554459
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IDA	25852083
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0048752	Process	Semicircular canal morphogenesis	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	ISS
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0060005	Process	Vestibular reflex	IEA
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	ISS
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IBA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IEA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	ISS
GO:0071870	Process	Cellular response to catecholamine stimulus	IEA
GO:0071870	Process	Cellular response to catecholamine stimulus	ISS
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097048	Process	Dendritic cell apoptotic process	IEA
GO:1900625	Process	Positive regulation of monocyte aggregation	IEA
GO:1900625	Process	Positive regulation of monocyte aggregation	IMP	20558821
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IGI	23554459
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IGI	23554459
GO:2000253	Process	Positive regulation of feeding behavior	IEA
GO:2000253	Process	Positive regulation of feeding behavior	ISS
GO:2000670	Process	Positive regulation of dendritic cell apoptotic process	IEA

Other IDs

• MIM: 600542
• HGNC: 7982
• e!Ensembl: ENSG00000119508

Protein

• UniProt ID: Q92570
• Protein name: Nuclear receptor subfamily 4 group A member 3 (Mitogen-induced nuclear orphan receptor) (Neuron-derived orphan receptor 1) (Nuclear hormone receptor NOR-1) (Translocated in extraskeletal chondrosarcoma)
• Protein function: Transcriptional activator that binds to regulatory elements in promoter regions in a cell- and response element (target)-specific manner. Induces gene expression by binding as monomers to the NR4A1 response element (NBRE) 5'-AAAAGGTCA-3' site an
• PDB: 8XTT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00105	zf-C4	290 → 359	Zinc finger, C4 type (two domains)	Domain
  PF00104	Hormone_recep	429 → 607	Ligand-binding domain of nuclear hormone receptor	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform alpha is highly expressed in skeletal muscle. Isoform beta is highly expressed in skeletal muscle and low expressed in fetal brain and placenta.
• Sequence:

  MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIST
  FVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPA
  SSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAV
  PTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALES
  HPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGEGTCAVCGDNAA
  CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
  VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC
  PTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVL
  RLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSAL
  SMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQR
  IFYLKLEDLVSPPSIIDKLFLDTLPF

• Sequence length: 626

Pathways

KEGG:

Transcriptional misregulation in cancer

Reactome:

Nuclear Receptor transcription pathway
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, JUVENILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROSARCOMA, EXTRASKELETAL MYXOID	—	CTD, HPO CTD, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRASKELETAL MYXOID CHONDROSARCOMA	—	ClinVar, Orphanet ClinVar, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	22583411, 23247046		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	24553175		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31724260		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	17197894		★☆☆☆☆ Found in Text Mining only
Andersen Syndrome	Andersen Syndrome	BEFREE	24395924		★☆☆☆☆ Found in Text Mining only
Anhydrotic Ectodermal Dysplasias	Hypohidrotic ectodermal dysplasia	BEFREE	7471507		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29047330		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31724260		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12522126, 20558821, 24806827		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	34248958	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35508128	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12225254, 8711779		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12522126, 20558821, 24806827		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34248958	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	25863735		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21118342, 9376078		★☆☆☆☆ Found in Text Mining only
Avascular necrosis of the capital femoral epiphysis	Avascular Necrosis Of The Capital Femoral Epiphysis	BEFREE	963906		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29414782		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20659174, 7760324		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	20659174	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	BEFREE	21725049		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10854708, 21996731, 26708018, 31175825, 31209222, 9070291		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24785096	Associate	★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	30821013		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32236623	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid tumor of lung	Carcinoid Tumor Of Lung	BEFREE	31724260		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31094928, 9713344		★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	34508546	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28165388, 30455429, 31498019		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30563885		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	10602519, 12543801, 15262426, 18587326, 18855877, 19775727, 22581839, 29327709, 31020999		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	12543801, 15262426		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	31020999	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chondrosarcoma Extraskeletal Myxoid	Extraskeletal myxoid chondrosarcoma	Pubtator	18587326, 18855877, 22569967, 24508382, 24746215, 27832806, 29327709, 29937513, 31020999, 35144048, 36316541, 36948401, 38447752, 38508521, 9060841	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	29377304		★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	7471507		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24553175		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29695901		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16821091		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23124592		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	25736269		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi syndrome	Pubtator	27486743	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27355625		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31701670		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12031950, 23602926		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12031950, 23602926		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19682370	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	30912283	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31936632	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22932816, 8911856		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19682370, 8359581		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	11126406		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	29207157	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	24553175		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	12826435		★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	10410173, 10602520, 10895826, 11679947, 12378528, 12543801, 14708728, 15188455, 15212958, 15262426, 15998372, 16112421, 18162764, 18855877, 22569967, 22592656, 22743288, 22804337, 23588370, 24508382, 24703573, 25130955, 28383167, 30353688, 31020999, 9781944		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	ORPHANET_DG	18855877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal myxoid chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibroid Tumor	Leiomyoma	BEFREE	23550059		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	11166081		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	25410408, 28367242		★☆☆☆☆ Found in Text Mining only
Hereditary Factor XI Deficiency	Hereditary Factor XI Deficiency	BEFREE	9491269		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	25976471		★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 1	Hereditary sensory and autonomic neuropathy	BEFREE	9722951		★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	15523651		★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	21546879	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	10741714		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	16005304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20558821		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	12813173, 28451892		★☆☆☆☆ Found in Text Mining only
Hypertension Renal	Renal hypertension	Pubtator	24085434	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12448597, 16772352		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28771489		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28771489		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29695901	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	15194176		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16998095		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	17096060		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29119290		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	12382154, 30563885		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	16174283		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	24433515		★☆☆☆☆ Found in Text Mining only
Legg-Calve-Perthes Disease	Legg-Calve-Perthes Disease	BEFREE	963906		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	23550059	Inhibit	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	30829727, 38508521	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Epithelioid	Leiomyosarcoma	BEFREE	30829727		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12813173, 23247046, 27697661		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18523155, 23247046, 27697661	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	36040481	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18523155, 23247046, 27697661, 37961948	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23247046	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	36040481	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17515897, 18523155, 21205929, 21725049, 22583411, 23247046, 24553175, 25410408, 27697661		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17515897		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	18162764		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23462179, 28232113, 29135101, 29227538		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	29119290		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	23053518		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	25410408, 28249906		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	24553175		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	7760324		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	7760324		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	7760324		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	7760324		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	7760324		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	7760324		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	7760324		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10854708, 21996731, 26708018, 31175825, 31209222, 9070291		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28165388, 30455429, 31498019		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27528092		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16373962, 23124592, 24553175, 27891591, 28367242		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24060638	Associate	★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	19429006		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	24806827		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21752397		★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	21205929, 25410408		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	15781666		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	34565470, 35886020	Associate	★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	18162764		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12819961, 19727524, 21803736, 23124592, 23831407, 27891591, 28367242		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26934447	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12543801, 12819961, 1350670, 15212958, 15998372, 21803736, 22583411, 22743288, 23124592, 23831407, 24528603, 24553175, 24746215, 25410408, 26301495, 27528092, 27697661, 27891591, 28249906, 28367242, 28423517, 29227538, 30227111, 30455429, 31183633, 31498019		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1350670, 24626568, 31183633, 7553599		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30227111, 8270251		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11781280, 19671840, 22143616		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30912283	Associate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	10741714		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25409614	Associate	★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30508646		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29695901	Associate	★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	24433515		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	24477469		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11884470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	33878706	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22743288, 30829727		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11475015, 20659174		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	20659174	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	36482877	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	31936632	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	8270251		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27528092		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27528092	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	22743288		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	29433971		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	BEFREE	27288358		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	27288358	Associate	★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	10961618		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30563885		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40586548	Inhibit	★☆☆☆☆ Found in Text Mining only
Usher syndrome type 2	Usher Syndrome	BEFREE	22147658		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23550059		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22049082	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	29695901	Associate	★☆☆☆☆ Found in Text Mining only