TRIM46 (tripartite motif containing 46)

Gene

• Entrez ID: 80128
• Gene name: Tripartite motif containing 46
• Gene symbol: TRIM46
• Synonyms (NCBI Gene): GENEY, TRIFIC
• Chromosome: 1
• Chromosome location: 1q22

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1455016	hsa-miR-1225-3p	CLIP-seq
MIRT1455017	hsa-miR-298	CLIP-seq
MIRT1455018	hsa-miR-3147	CLIP-seq
MIRT1455019	hsa-miR-331-3p	CLIP-seq
MIRT1455020	hsa-miR-4253	CLIP-seq
MIRT1455021	hsa-miR-4292	CLIP-seq
MIRT1455022	hsa-miR-4425	CLIP-seq
MIRT1455023	hsa-miR-4706	CLIP-seq
MIRT1455024	hsa-miR-4734	CLIP-seq
MIRT1455025	hsa-miR-4749-5p	CLIP-seq
MIRT1455026	hsa-miR-541	CLIP-seq
MIRT1455027	hsa-miR-604	CLIP-seq
MIRT1455028	hsa-miR-609	CLIP-seq
MIRT1455029	hsa-miR-654-5p	CLIP-seq
MIRT1455030	hsa-miR-744	CLIP-seq
MIRT2136349	hsa-miR-1275	CLIP-seq
MIRT2136350	hsa-miR-22	CLIP-seq
MIRT2136351	hsa-miR-3175	CLIP-seq
MIRT2136352	hsa-miR-421	CLIP-seq
MIRT2136353	hsa-miR-4260	CLIP-seq
MIRT2136354	hsa-miR-4291	CLIP-seq
MIRT2136355	hsa-miR-4310	CLIP-seq
MIRT2136356	hsa-miR-4434	CLIP-seq
MIRT2136357	hsa-miR-4436b-3p	CLIP-seq
MIRT2136358	hsa-miR-4516	CLIP-seq
MIRT2136359	hsa-miR-4525	CLIP-seq
MIRT2136360	hsa-miR-4665-5p	CLIP-seq
MIRT2136361	hsa-miR-4709-5p	CLIP-seq
MIRT2136362	hsa-miR-4723-5p	CLIP-seq
MIRT2136363	hsa-miR-4755-3p	CLIP-seq
MIRT2136364	hsa-miR-625	CLIP-seq
MIRT2357267	hsa-miR-1178	CLIP-seq
MIRT2357268	hsa-miR-3065-3p	CLIP-seq
MIRT2357269	hsa-miR-4650-5p	CLIP-seq
MIRT2357270	hsa-miR-4747-5p	CLIP-seq
MIRT2136349	hsa-miR-1275	CLIP-seq
MIRT2136351	hsa-miR-3175	CLIP-seq
MIRT2136353	hsa-miR-4260	CLIP-seq
MIRT2136356	hsa-miR-4434	CLIP-seq
MIRT2136358	hsa-miR-4516	CLIP-seq
MIRT2136359	hsa-miR-4525	CLIP-seq
MIRT2136360	hsa-miR-4665-5p	CLIP-seq
MIRT2136362	hsa-miR-4723-5p	CLIP-seq
MIRT2136364	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0001578	Process	Microtubule bundle formation	IBA
GO:0001578	Process	Microtubule bundle formation	IEA
GO:0001764	Process	Neuron migration	IBA
GO:0001764	Process	Neuron migration	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030424	Component	Axon	IEA
GO:0030517	Process	Negative regulation of axon extension	ISS
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032880	Process	Regulation of protein localization	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043194	Component	Axon initial segment	IEA
GO:0044304	Component	Main axon	IBA
GO:0044304	Component	Main axon	IEA
GO:0044304	Component	Main axon	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048490	Process	Anterograde synaptic vesicle transport	IBA
GO:0048490	Process	Anterograde synaptic vesicle transport	IEA
GO:0099612	Process	Protein localization to axon	IEA
GO:1901953	Process	Positive regulation of anterograde dense core granule transport	ISS
GO:1904115	Component	Axon cytoplasm	IEA
GO:1990769	Component	Proximal neuron projection	IEA

Other IDs

• MIM: 600986
• HGNC: 19019
• e!Ensembl: ENSG00000163462

Protein

• UniProt ID: Q7Z4K8
• Protein name: Tripartite motif-containing protein 46 (Gene Y protein) (GeneY) (Tripartite, fibronectin type-III and C-terminal SPRY motif protein)
• Protein function: Microtubule-associated protein that is involved in the formation of parallel microtubule bundles linked by cross-bridges in the proximal axon. Required for the uniform orientation and maintenance of the parallel microtubule fascicles, which are
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13445	zf-RING_UBOX	33 → 77	RING-type zinc-finger	Domain
  PF00643	zf-B_box	222 → 263	B-box zinc finger	Domain
  PF18568	COS	373 → 422	TRIM C-terminal subgroup One Signature domain	Domain

• Sequence:

  MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
  LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
  LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
  EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
  CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVR
  HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGS
  GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
  LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
  QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWG
  ASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
  ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGK
  ILLGSGASSNAGLTGRDGPTAGCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
  SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD

• Sequence length: 759

Pathways

Reactome:

Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY TRACT CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	23263486		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27110773		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	34459501	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	34487731	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29028942	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	28252667, 36221101	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	34459501	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35354796	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27110773		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29028942		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34638981	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26599082		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38095640	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28904989		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29028942		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	37652501	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22938426, 29028942, 37652501	Associate	★☆☆☆☆ Found in Text Mining only