LRRTM4 (leucine rich repeat transmembrane neuronal 4)

Gene

• Entrez ID: 80059
• Gene name: Leucine rich repeat transmembrane neuronal 4
• Gene symbol: LRRTM4
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2p12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT527180	hsa-miR-205-5p	PAR-CLIP	22012620
MIRT527179	hsa-miR-1297	PAR-CLIP	22012620
MIRT527178	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT527177	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT527176	hsa-miR-4465	PAR-CLIP	22012620
MIRT527175	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT527173	hsa-miR-1305	PAR-CLIP	22012620
MIRT527179	hsa-miR-1297	PAR-CLIP	27292025
MIRT527173	hsa-miR-1305	PAR-CLIP	27292025
MIRT527180	hsa-miR-205-5p	PAR-CLIP	27292025
MIRT527178	hsa-miR-26a-5p	PAR-CLIP	27292025
MIRT527177	hsa-miR-26b-5p	PAR-CLIP	27292025
MIRT527176	hsa-miR-4465	PAR-CLIP	27292025
MIRT527175	hsa-miR-6868-3p	PAR-CLIP	27292025
MIRT527180	hsa-miR-205-5p	PAR-CLIP	22012620
MIRT527179	hsa-miR-1297	PAR-CLIP	22012620
MIRT527178	hsa-miR-26a-5p	PAR-CLIP	22012620
MIRT527177	hsa-miR-26b-5p	PAR-CLIP	22012620
MIRT527176	hsa-miR-4465	PAR-CLIP	22012620
MIRT527175	hsa-miR-6868-3p	PAR-CLIP	22012620
MIRT527173	hsa-miR-1305	PAR-CLIP	22012620
MIRT1121109	hsa-miR-1470	CLIP-seq
MIRT1121110	hsa-miR-3614-3p	CLIP-seq
MIRT1121111	hsa-miR-3651	CLIP-seq
MIRT1121112	hsa-miR-4290	CLIP-seq
MIRT1121113	hsa-miR-4469	CLIP-seq
MIRT1121114	hsa-miR-4493	CLIP-seq
MIRT1121115	hsa-miR-4540	CLIP-seq
MIRT1121116	hsa-miR-4667-3p	CLIP-seq
MIRT1121117	hsa-miR-1245	CLIP-seq
MIRT1121118	hsa-miR-1324	CLIP-seq
MIRT1121119	hsa-miR-3133	CLIP-seq
MIRT1121120	hsa-miR-338-3p	CLIP-seq
MIRT1121121	hsa-miR-3591-3p	CLIP-seq
MIRT1121122	hsa-miR-4530	CLIP-seq
MIRT1121123	hsa-miR-4668-3p	CLIP-seq
MIRT1121124	hsa-miR-4765	CLIP-seq
MIRT1121125	hsa-miR-548b-3p	CLIP-seq
MIRT2453428	hsa-miR-1273g	CLIP-seq
MIRT2453429	hsa-miR-331-3p	CLIP-seq
MIRT2453430	hsa-miR-3925-3p	CLIP-seq
MIRT2453431	hsa-miR-4690-3p	CLIP-seq
MIRT2453432	hsa-miR-515-5p	CLIP-seq
MIRT2453433	hsa-miR-766	CLIP-seq
MIRT1121119	hsa-miR-3133	CLIP-seq
MIRT2563604	hsa-miR-323-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IBA

Other IDs

• MIM: 610870
• HGNC: 19411
• e!Ensembl: ENSG00000176204

Protein

• UniProt ID: Q86VH4
• Protein name: Leucine-rich repeat transmembrane neuronal protein 4
• Protein function: May play a role in the development and maintenance of the vertebrate nervous system. Exhibits strong synaptogenic activity, restricted to excitatory presynaptic differentiation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	64 → 121	Leucine rich repeat	Repeat
  PF13855	LRR_8	109 → 169	Leucine rich repeat	Repeat
  PF13855	LRR_8	157 → 217	Leucine rich repeat	Repeat
  PF13855	LRR_8	229 → 289	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Expressed in neuronal tissues. {ECO:0000269|PubMed:12676565}.
• Sequence:

  MGFHLITQLKGMSVVLVLLPTLLLVMLTGAQRACPKNCRCDGKIVYCESHAFADIPENIS
  GGSQGLSLRFNSIQKLKSNQFAGLNQLIWLYLDHNYISSVDEDAFQGIRRLKELILSSNK
  ITYLHNKTFHPVPNLRNLDLSYNKLQTLQSEQFKGLRKLIILHLRSNSLKTVPIRVFQDC
  RNLDFLDLGYNRLRSLSRNAFAGLLKLKELHLEHNQFSKINFAHFPRLFNLRSIYLQWNR
  IRSISQGLTWTWSSLHNLDLSGNDIQGIEPGTFKCLPNLQKLNLDSNKLTNISQETVNAW
  ISLISITLSGNMWECSRSICPLFYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNIC
  SEVQVVNTERSHLVPQTPQKPLIIPRPTIFKPDVTQSTFETPSPSPGFQIPGAEQEYEHV
  SFHKIIAGSVALFLSVAMILLVIYVSWKRYPASMKQLQQHSLMKRRRKKARESERQMNSP
  LQEYYVDYKPTNSETMDISVNGSGPCTYTISGSRECEMPHHMKPLPYYSYDQPVIGYCQA
  HQPLHVTKGYETVSPEQDESPGLELGRDHSFIATIARSAAPAIYLERIAN

• Sequence length: 590

Pathways

Reactome:

Neurexins and neuroligins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXOSTOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LRRTM4-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Age related macular degeneration	Age-related macular degeneration	BEFREE	29760528		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	34684344	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	35052406	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	35052406	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	35052406	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	31854516	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	35994481	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34684344	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Macular degeneration	Macular Degeneration	BEFREE	29760528		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	GWASCAT_DG	27082954		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tourette Syndrome	Tourette syndrome	Pubtator	35052406	Associate	★☆☆☆☆ Found in Text Mining only