Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80031
Gene name	Semaphorin 6D
Gene symbol	SEMA6D
Synonyms (NCBI Gene)	-
Chromosome	15
Chromosome location	15q21.1
Summary	Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a

247

Show/Hide all (247)

miRTarBase ID	miRNA	Experiments	Reference
MIRT607440	hsa-miR-8485	HITS-CLIP	23313552
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT607440	hsa-miR-8485	HITS-CLIP	23313552
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT608380	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT608380	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT608380	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT666452	hsa-miR-1225-5p	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT619566	hsa-miR-8068	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT619566	hsa-miR-8068	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT619566	hsa-miR-8068	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	24906430
MIRT608380	hsa-miR-589-3p	HITS-CLIP	24906430
MIRT607440	hsa-miR-8485	HITS-CLIP	24906430
MIRT608380	hsa-miR-589-3p	HITS-CLIP	24906430
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	24906430
MIRT607440	hsa-miR-8485	HITS-CLIP	24906430
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	24906430
MIRT565782	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT281198	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT281196	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT281199	hsa-miR-23c	PAR-CLIP	20371350
MIRT281197	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT281200	hsa-miR-3662	PAR-CLIP	20371350
MIRT565781	hsa-miR-4506	PAR-CLIP	20371350
MIRT565780	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT565779	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT607440	hsa-miR-8485	HITS-CLIP	23313552
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT607440	hsa-miR-8485	HITS-CLIP	23313552
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT608380	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT608380	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT608380	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT666452	hsa-miR-1225-5p	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT619566	hsa-miR-8068	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT619566	hsa-miR-8068	HITS-CLIP	23824327
MIRT607441	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT607439	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT619566	hsa-miR-8068	HITS-CLIP	23824327
MIRT607440	hsa-miR-8485	HITS-CLIP	23824327
MIRT565782	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT281198	hsa-miR-130a-5p	PAR-CLIP	20371350
MIRT281196	hsa-miR-23a-3p	PAR-CLIP	20371350
MIRT281199	hsa-miR-23c	PAR-CLIP	20371350
MIRT281197	hsa-miR-23b-3p	PAR-CLIP	20371350
MIRT281200	hsa-miR-3662	PAR-CLIP	20371350
MIRT565781	hsa-miR-4506	PAR-CLIP	20371350
MIRT565780	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT565779	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT1335547	hsa-miR-129-5p	CLIP-seq
MIRT1335548	hsa-miR-19a	CLIP-seq
MIRT1335549	hsa-miR-19b	CLIP-seq
MIRT1335550	hsa-miR-2113	CLIP-seq
MIRT1335551	hsa-miR-4696	CLIP-seq
MIRT1335552	hsa-miR-489	CLIP-seq
MIRT1335553	hsa-miR-514	CLIP-seq
MIRT1335554	hsa-miR-514b-3p	CLIP-seq
MIRT1335555	hsa-miR-2117	CLIP-seq
MIRT1335556	hsa-miR-300	CLIP-seq
MIRT1335557	hsa-miR-381	CLIP-seq
MIRT1335558	hsa-miR-4753-3p	CLIP-seq
MIRT1335559	hsa-miR-659	CLIP-seq
MIRT1335560	hsa-miR-1	CLIP-seq
MIRT1335561	hsa-miR-1273d	CLIP-seq
MIRT1335562	hsa-miR-1297	CLIP-seq
MIRT1335563	hsa-miR-1305	CLIP-seq
MIRT1335564	hsa-miR-206	CLIP-seq
MIRT1335565	hsa-miR-26a	CLIP-seq
MIRT1335566	hsa-miR-26b	CLIP-seq
MIRT1335567	hsa-miR-27a	CLIP-seq
MIRT1335568	hsa-miR-27b	CLIP-seq
MIRT1335569	hsa-miR-3673	CLIP-seq
MIRT1335570	hsa-miR-375	CLIP-seq
MIRT1335571	hsa-miR-4433	CLIP-seq
MIRT1335572	hsa-miR-4465	CLIP-seq
MIRT1335573	hsa-miR-498	CLIP-seq
MIRT1335574	hsa-miR-613	CLIP-seq
MIRT1335575	hsa-miR-660	CLIP-seq
MIRT1335562	hsa-miR-1297	CLIP-seq
MIRT1335576	hsa-miR-1911	CLIP-seq
MIRT1335565	hsa-miR-26a	CLIP-seq
MIRT1335566	hsa-miR-26b	CLIP-seq
MIRT1335567	hsa-miR-27a	CLIP-seq
MIRT1335568	hsa-miR-27b	CLIP-seq
MIRT1335577	hsa-miR-31	CLIP-seq
MIRT1335578	hsa-miR-3128	CLIP-seq
MIRT1335579	hsa-miR-320e	CLIP-seq
MIRT1335570	hsa-miR-375	CLIP-seq
MIRT1335580	hsa-miR-4463	CLIP-seq
MIRT1335572	hsa-miR-4465	CLIP-seq
MIRT1335581	hsa-miR-452	CLIP-seq
MIRT1335582	hsa-miR-4695-3p	CLIP-seq
MIRT1335551	hsa-miR-4696	CLIP-seq
MIRT2099207	hsa-miR-23a	CLIP-seq
MIRT2099208	hsa-miR-23b	CLIP-seq
MIRT1335576	hsa-miR-1911	CLIP-seq
MIRT1335570	hsa-miR-375	CLIP-seq
MIRT1335581	hsa-miR-452	CLIP-seq
MIRT2619817	hsa-miR-1184	CLIP-seq
MIRT2619818	hsa-miR-1205	CLIP-seq
MIRT2619819	hsa-miR-1208	CLIP-seq
MIRT2619820	hsa-miR-1258	CLIP-seq
MIRT2619821	hsa-miR-132	CLIP-seq
MIRT2619822	hsa-miR-140-5p	CLIP-seq
MIRT2619823	hsa-miR-1912	CLIP-seq
MIRT2619824	hsa-miR-212	CLIP-seq
MIRT2619825	hsa-miR-214	CLIP-seq
MIRT2099207	hsa-miR-23a	CLIP-seq
MIRT2099208	hsa-miR-23b	CLIP-seq
MIRT2619826	hsa-miR-25	CLIP-seq
MIRT2619827	hsa-miR-296-3p	CLIP-seq
MIRT2619828	hsa-miR-3130-5p	CLIP-seq
MIRT2619829	hsa-miR-3158-5p	CLIP-seq
MIRT2619830	hsa-miR-32	CLIP-seq
MIRT2619831	hsa-miR-323-3p	CLIP-seq
MIRT2619832	hsa-miR-3619-5p	CLIP-seq
MIRT2619833	hsa-miR-363	CLIP-seq
MIRT2619834	hsa-miR-3646	CLIP-seq
MIRT2619835	hsa-miR-3665	CLIP-seq
MIRT2619836	hsa-miR-367	CLIP-seq
MIRT2619837	hsa-miR-3934	CLIP-seq
MIRT2619838	hsa-miR-4275	CLIP-seq
MIRT2619839	hsa-miR-4291	CLIP-seq
MIRT2619840	hsa-miR-4464	CLIP-seq
MIRT2619841	hsa-miR-4482	CLIP-seq
MIRT2619842	hsa-miR-4494	CLIP-seq
MIRT1335581	hsa-miR-452	CLIP-seq
MIRT2619843	hsa-miR-4652-3p	CLIP-seq
MIRT2619844	hsa-miR-4727-5p	CLIP-seq
MIRT2619845	hsa-miR-4748	CLIP-seq
MIRT2619846	hsa-miR-4769-3p	CLIP-seq
MIRT2619847	hsa-miR-494	CLIP-seq
MIRT2619848	hsa-miR-544	CLIP-seq
MIRT2619849	hsa-miR-597	CLIP-seq
MIRT2619850	hsa-miR-657	CLIP-seq
MIRT2619851	hsa-miR-761	CLIP-seq
MIRT2619852	hsa-miR-767-5p	CLIP-seq
MIRT2619853	hsa-miR-922	CLIP-seq
MIRT2619854	hsa-miR-92a	CLIP-seq
MIRT2619855	hsa-miR-92b	CLIP-seq
MIRT2619817	hsa-miR-1184	CLIP-seq
MIRT2619818	hsa-miR-1205	CLIP-seq
MIRT2619819	hsa-miR-1208	CLIP-seq
MIRT2619820	hsa-miR-1258	CLIP-seq
MIRT2619821	hsa-miR-132	CLIP-seq
MIRT2619822	hsa-miR-140-5p	CLIP-seq
MIRT2619823	hsa-miR-1912	CLIP-seq
MIRT2619824	hsa-miR-212	CLIP-seq
MIRT2619825	hsa-miR-214	CLIP-seq
MIRT2099207	hsa-miR-23a	CLIP-seq
MIRT2099208	hsa-miR-23b	CLIP-seq
MIRT2619826	hsa-miR-25	CLIP-seq
MIRT2619827	hsa-miR-296-3p	CLIP-seq
MIRT2619828	hsa-miR-3130-5p	CLIP-seq
MIRT2619829	hsa-miR-3158-5p	CLIP-seq
MIRT2619830	hsa-miR-32	CLIP-seq
MIRT2619831	hsa-miR-323-3p	CLIP-seq
MIRT2619832	hsa-miR-3619-5p	CLIP-seq
MIRT2619833	hsa-miR-363	CLIP-seq
MIRT2619834	hsa-miR-3646	CLIP-seq
MIRT2619835	hsa-miR-3665	CLIP-seq
MIRT2619836	hsa-miR-367	CLIP-seq
MIRT2619837	hsa-miR-3934	CLIP-seq
MIRT2619838	hsa-miR-4275	CLIP-seq
MIRT2619839	hsa-miR-4291	CLIP-seq
MIRT2619840	hsa-miR-4464	CLIP-seq
MIRT2619841	hsa-miR-4482	CLIP-seq
MIRT2619842	hsa-miR-4494	CLIP-seq
MIRT1335581	hsa-miR-452	CLIP-seq
MIRT2619843	hsa-miR-4652-3p	CLIP-seq
MIRT2619844	hsa-miR-4727-5p	CLIP-seq
MIRT2619845	hsa-miR-4748	CLIP-seq
MIRT2619846	hsa-miR-4769-3p	CLIP-seq
MIRT2619847	hsa-miR-494	CLIP-seq
MIRT2690383	hsa-miR-520d-5p	CLIP-seq
MIRT2690384	hsa-miR-524-5p	CLIP-seq
MIRT2619848	hsa-miR-544	CLIP-seq
MIRT2619849	hsa-miR-597	CLIP-seq
MIRT2690385	hsa-miR-624	CLIP-seq
MIRT2619850	hsa-miR-657	CLIP-seq
MIRT2619851	hsa-miR-761	CLIP-seq
MIRT2619852	hsa-miR-767-5p	CLIP-seq
MIRT2619853	hsa-miR-922	CLIP-seq
MIRT2619854	hsa-miR-92a	CLIP-seq
MIRT2619855	hsa-miR-92b	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IBA
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	16715077
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IEA
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	12110693
GO:0005794	Component	Golgi apparatus	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0009986	Component	Cell surface	IMP	12110693
GO:0014909	Process	Smooth muscle cell migration	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0014912	Process	Negative regulation of smooth muscle cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0021591	Process	Ventricular system development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030215	Function	Semaphorin receptor binding	IBA
GO:0030215	Function	Semaphorin receptor binding	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030517	Process	Negative regulation of axon extension	IDA	12110693
GO:0045499	Function	Chemorepellent activity	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048018	Function	Receptor ligand activity	ISS
GO:0050919	Process	Negative chemotaxis	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IDA	16715077
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS

MIM	HGNC	e!Ensembl
609295	16770	ENSG00000137872

Q8NFY4

Protein name

Semaphorin-6D

Protein function

Shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro. May be a stop signal for the DRG neurons in their target areas, and possibly also for other neurons. May also be involved in the maintenance and remodeling of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01403	Sema	61 → 481	Sema domain	Family
PF01437	PSI	514 → 569	Plexin repeat	Family

Sequence

MRVFLLCAYILLLMVSQLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEMPKTEVIPNKKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLSTLEYDGEEISGLARCPFDARQTNVALFAD
GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
AVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSI
TDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPED
KVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHPLMDSAVPPIADEPWFTKTRVRYR
LTAISVDHSAGPYQNYTVIFVGSEAGMVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCSAE
NEEDKKVISLQLDKDHHALYVAFSSCIIRIPLSRCERYGSCKKSCIASRDPYCGWLSQGS
CGRVTPGMLAEGYEQDTEFGNTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVSSSSVTTM
ASIPEITPKVIDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQSGESNQMVH
MNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKDAESAQSCTDSSGSFAKLNGL
FDSPVKEYQQNIDSPKLYSNLLTSRKELPPNGDTKSMVMDHRGQPPELAALPTPESTPVL
HQKTLQAMKSHSEKAHGHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTS
FSNSNAHKAEKKLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDI
QMAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLER
QRGYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSMNRGGYMPTPTGAKVDYIQGTPVSVH
LQPSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTPSVRPLNKYTY

Sequence length

1073

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		Other semaphorin interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (38)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET'S SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HOARDING DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEMA6D-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	34573389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	GWASCAT_DG	29325848, 30610198, 30818988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Body Weight	Body weight	Pubtator	34573389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32887275	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	24871321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37886648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	33960276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	30592759	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	28008999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	24871321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language Development Disorders	BEFREE	22266071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	22266071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	28440294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	30592759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	30592759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085, 30718901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26553456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19176370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25961939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32472335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	30592759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17143962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17143962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	28008999		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

SEMA6D (semaphorin 6D)