Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80019
Gene name	Ubiquitin domain containing 1
Gene symbol	UBTD1
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q24.1-q24.2
Summary	The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments
MIRT1471696	hsa-miR-3977	CLIP-seq
MIRT1471697	hsa-miR-4419a	CLIP-seq
MIRT1471698	hsa-miR-4510	CLIP-seq
MIRT1471699	hsa-miR-4779	CLIP-seq
MIRT1471700	hsa-miR-646	CLIP-seq
MIRT2141986	hsa-miR-15a	CLIP-seq
MIRT2141987	hsa-miR-15b	CLIP-seq
MIRT2141988	hsa-miR-16	CLIP-seq
MIRT2141989	hsa-miR-195	CLIP-seq
MIRT2141990	hsa-miR-2277-3p	CLIP-seq
MIRT2141991	hsa-miR-3202	CLIP-seq
MIRT2141992	hsa-miR-3714	CLIP-seq
MIRT2141993	hsa-miR-424	CLIP-seq
MIRT2141994	hsa-miR-4533	CLIP-seq
MIRT2141995	hsa-miR-497	CLIP-seq
MIRT2362588	hsa-miR-1207-5p	CLIP-seq
MIRT2362589	hsa-miR-1291	CLIP-seq
MIRT2141986	hsa-miR-15a	CLIP-seq
MIRT2141987	hsa-miR-15b	CLIP-seq
MIRT2141988	hsa-miR-16	CLIP-seq
MIRT2141989	hsa-miR-195	CLIP-seq
MIRT2362590	hsa-miR-214	CLIP-seq
MIRT2141990	hsa-miR-2277-3p	CLIP-seq
MIRT2141991	hsa-miR-3202	CLIP-seq
MIRT2362591	hsa-miR-3616-3p	CLIP-seq
MIRT2362592	hsa-miR-3619-5p	CLIP-seq
MIRT2141992	hsa-miR-3714	CLIP-seq
MIRT2141993	hsa-miR-424	CLIP-seq
MIRT2362593	hsa-miR-4447	CLIP-seq
MIRT2362594	hsa-miR-4472	CLIP-seq
MIRT2362595	hsa-miR-4488	CLIP-seq
MIRT2362596	hsa-miR-4514	CLIP-seq
MIRT2141994	hsa-miR-4533	CLIP-seq
MIRT2362597	hsa-miR-4692	CLIP-seq
MIRT2362598	hsa-miR-4697-5p	CLIP-seq
MIRT2362599	hsa-miR-4710	CLIP-seq
MIRT2362600	hsa-miR-4721	CLIP-seq
MIRT2362601	hsa-miR-4763-3p	CLIP-seq
MIRT2141995	hsa-miR-497	CLIP-seq
MIRT2362602	hsa-miR-761	CLIP-seq
MIRT2362603	hsa-miR-940	CLIP-seq
MIRT2396613	hsa-miR-1245b-3p	CLIP-seq
MIRT2396614	hsa-miR-1285	CLIP-seq
MIRT2396615	hsa-miR-29a	CLIP-seq
MIRT2396616	hsa-miR-29b	CLIP-seq
MIRT2396617	hsa-miR-29c	CLIP-seq
MIRT2396618	hsa-miR-3065-3p	CLIP-seq
MIRT2396619	hsa-miR-3187-5p	CLIP-seq
MIRT2396620	hsa-miR-378g	CLIP-seq
MIRT2396621	hsa-miR-4437	CLIP-seq
MIRT2396622	hsa-miR-4486	CLIP-seq
MIRT2396623	hsa-miR-4674	CLIP-seq
MIRT2396624	hsa-miR-4685-5p	CLIP-seq
MIRT2396625	hsa-miR-612	CLIP-seq
MIRT2362588	hsa-miR-1207-5p	CLIP-seq
MIRT2656536	hsa-miR-1225-5p	CLIP-seq
MIRT2656537	hsa-miR-147	CLIP-seq
MIRT2656538	hsa-miR-1827	CLIP-seq
MIRT2656539	hsa-miR-1915	CLIP-seq
MIRT2656540	hsa-miR-218	CLIP-seq
MIRT2656541	hsa-miR-2467-3p	CLIP-seq
MIRT2656542	hsa-miR-3175	CLIP-seq
MIRT2656543	hsa-miR-3911	CLIP-seq
MIRT2656544	hsa-miR-3922-5p	CLIP-seq
MIRT2656545	hsa-miR-4270	CLIP-seq
MIRT2656546	hsa-miR-4292	CLIP-seq
MIRT2656547	hsa-miR-4308	CLIP-seq
MIRT1471697	hsa-miR-4419a	CLIP-seq
MIRT2656548	hsa-miR-4441	CLIP-seq
MIRT2656549	hsa-miR-4474-3p	CLIP-seq
MIRT2362595	hsa-miR-4488	CLIP-seq
MIRT1471698	hsa-miR-4510	CLIP-seq
MIRT2656550	hsa-miR-4655-5p	CLIP-seq
MIRT2656551	hsa-miR-4684-3p	CLIP-seq
MIRT2656552	hsa-miR-4690-3p	CLIP-seq
MIRT2362598	hsa-miR-4697-5p	CLIP-seq
MIRT2656553	hsa-miR-4708-3p	CLIP-seq
MIRT2656554	hsa-miR-4727-5p	CLIP-seq
MIRT2656555	hsa-miR-4731-5p	CLIP-seq
MIRT2656556	hsa-miR-4747-3p	CLIP-seq
MIRT2362601	hsa-miR-4763-3p	CLIP-seq
MIRT2656557	hsa-miR-4763-5p	CLIP-seq
MIRT2656558	hsa-miR-4769-3p	CLIP-seq
MIRT1471699	hsa-miR-4779	CLIP-seq
MIRT2656559	hsa-miR-486-3p	CLIP-seq
MIRT2656560	hsa-miR-604	CLIP-seq
MIRT2656561	hsa-miR-624	CLIP-seq
MIRT2656562	hsa-miR-637	CLIP-seq
MIRT2656563	hsa-miR-644	CLIP-seq
MIRT1471700	hsa-miR-646	CLIP-seq
MIRT2656564	hsa-miR-647	CLIP-seq
MIRT2656539	hsa-miR-1915	CLIP-seq
MIRT2656541	hsa-miR-2467-3p	CLIP-seq
MIRT2656542	hsa-miR-3175	CLIP-seq
MIRT1471696	hsa-miR-3977	CLIP-seq
MIRT1471697	hsa-miR-4419a	CLIP-seq
MIRT2362595	hsa-miR-4488	CLIP-seq
MIRT1471698	hsa-miR-4510	CLIP-seq
MIRT2656552	hsa-miR-4690-3p	CLIP-seq
MIRT2362598	hsa-miR-4697-5p	CLIP-seq
MIRT2694694	hsa-miR-4725-5p	CLIP-seq
MIRT1471699	hsa-miR-4779	CLIP-seq
MIRT2656559	hsa-miR-486-3p	CLIP-seq
MIRT2694695	hsa-miR-504	CLIP-seq
MIRT1471700	hsa-miR-646	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 19549727, 24211586, 25416956, 32296183, 33961781

MIM	HGNC	e!Ensembl
616388	25683	ENSG00000165886

Q9HAC8

Protein name

Ubiquitin domain-containing protein 1

Protein function

May be involved in the regulation of cellular senescence through a positive feedback loop with TP53. Is a TP53 downstream target gene that increases the stability of TP53 protein by promoting the ubiquitination and degradation of MDM2. {ECO:0000

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16455	UBD	25 → 129	Ubiquitin-binding domain	Domain
PF00240	ubiquitin	151 → 222	Ubiquitin family	Domain

Sequence

MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCL
SPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHA
QEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD

Sequence length

227

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	32444848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32483419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30804013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30804013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25382750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30804013		★★★★★ ★☆☆☆☆ Found in Text Mining only

UBTD1 (ubiquitin domain containing 1)