Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80018
Gene name	N-alpha-acetyltransferase 25, NatB auxiliary subunit
Gene symbol	NAA25
Synonyms (NCBI Gene)	C12orf30MDM20NAP1
Chromosome	12
Chromosome location	12q24.13
Summary	This gene encodes the auxiliary subunit of the heteromeric N-terminal acetyltransferase B complex. This complex acetylates methionine residues that are followed by acidic or asparagine residues.[provided by RefSeq, Mar 2010]

482

Show/Hide all (482)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005228	hsa-let-7b-5p	pSILAC	18668040
MIRT005259	hsa-miR-16-5p	pSILAC	18668040
MIRT020629	hsa-miR-155-5p	Proteomics	18668040
MIRT023442	hsa-miR-30b-5p	Sequencing	20371350
MIRT005259	hsa-miR-16-5p	Proteomics	18668040
MIRT005228	hsa-let-7b-5p	Proteomics	18668040
MIRT049287	hsa-miR-92a-3p	CLASH	23622248
MIRT510036	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT510035	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510033	hsa-miR-3924	HITS-CLIP	21572407
MIRT522376	hsa-miR-6507-5p	HITS-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506471	hsa-miR-552-5p	HITS-CLIP	21572407
MIRT510036	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT510035	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510033	hsa-miR-3924	HITS-CLIP	21572407
MIRT522376	hsa-miR-6507-5p	HITS-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506471	hsa-miR-552-5p	HITS-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT510036	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT510035	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT510033	hsa-miR-3924	PAR-CLIP	20371350
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT510036	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT510035	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510033	hsa-miR-3924	PAR-CLIP	21572407
MIRT522376	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT556007	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT506471	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT472666	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT005259	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT472665	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT472664	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT472663	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT472662	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT472661	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT472660	hsa-miR-4506	PAR-CLIP	21572407
MIRT472658	hsa-miR-5571-5p	PAR-CLIP	21572407
MIRT472659	hsa-miR-3908	PAR-CLIP	21572407
MIRT472657	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT472656	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT472655	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT472653	hsa-miR-6716-5p	PAR-CLIP	21572407
MIRT472652	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT472651	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT472650	hsa-miR-450a-1-3p	PAR-CLIP	21572407
MIRT472649	hsa-miR-3122	PAR-CLIP	21572407
MIRT472648	hsa-miR-3913-5p	PAR-CLIP	21572407
MIRT472647	hsa-miR-887-5p	PAR-CLIP	21572407
MIRT472646	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT472654	hsa-miR-3140-3p	PAR-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT510036	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT510035	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510033	hsa-miR-3924	PAR-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT510036	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT510035	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510033	hsa-miR-3924	PAR-CLIP	23446348
MIRT522376	hsa-miR-6507-5p	PAR-CLIP	23446348
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506471	hsa-miR-552-5p	PAR-CLIP	23446348
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510036	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT510035	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510033	hsa-miR-3924	PAR-CLIP	23446348
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506471	hsa-miR-552-5p	PAR-CLIP	23446348
MIRT472666	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT005259	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT472665	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT472664	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT472663	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT472662	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT472661	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT472660	hsa-miR-4506	PAR-CLIP	23592263
MIRT472658	hsa-miR-5571-5p	PAR-CLIP	23592263
MIRT472659	hsa-miR-3908	PAR-CLIP	23592263
MIRT472657	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT472656	hsa-miR-6515-3p	PAR-CLIP	23592263
MIRT472655	hsa-miR-1236-3p	PAR-CLIP	23592263
MIRT472654	hsa-miR-3140-3p	PAR-CLIP	23592263
MIRT472653	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT472652	hsa-miR-4753-3p	PAR-CLIP	23592263
MIRT472651	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT472650	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT472649	hsa-miR-3122	PAR-CLIP	23592263
MIRT472648	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT472647	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT472646	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT510036	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT510035	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510033	hsa-miR-3924	HITS-CLIP	21572407
MIRT522376	hsa-miR-6507-5p	HITS-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506471	hsa-miR-552-5p	HITS-CLIP	21572407
MIRT510036	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT510035	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510033	hsa-miR-3924	HITS-CLIP	21572407
MIRT522376	hsa-miR-6507-5p	HITS-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506471	hsa-miR-552-5p	HITS-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT510036	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT510035	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT510033	hsa-miR-3924	PAR-CLIP	20371350
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT510036	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT510035	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510033	hsa-miR-3924	PAR-CLIP	21572407
MIRT522376	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT556007	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT506471	hsa-miR-552-5p	PAR-CLIP	21572407
MIRT472666	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT005259	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT472665	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT472664	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT472663	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT472662	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT472661	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT472660	hsa-miR-4506	PAR-CLIP	21572407
MIRT472658	hsa-miR-5571-5p	PAR-CLIP	21572407
MIRT472659	hsa-miR-3908	PAR-CLIP	21572407
MIRT472657	hsa-miR-5002-5p	PAR-CLIP	21572407
MIRT472656	hsa-miR-6515-3p	PAR-CLIP	21572407
MIRT472655	hsa-miR-1236-3p	PAR-CLIP	21572407
MIRT472653	hsa-miR-6716-5p	PAR-CLIP	21572407
MIRT472652	hsa-miR-4753-3p	PAR-CLIP	21572407
MIRT472651	hsa-miR-6809-3p	PAR-CLIP	21572407
MIRT472650	hsa-miR-450a-1-3p	PAR-CLIP	21572407
MIRT472649	hsa-miR-3122	PAR-CLIP	21572407
MIRT472648	hsa-miR-3913-5p	PAR-CLIP	21572407
MIRT472647	hsa-miR-887-5p	PAR-CLIP	21572407
MIRT472646	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT472654	hsa-miR-3140-3p	PAR-CLIP	21572407
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT510036	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT510035	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510033	hsa-miR-3924	PAR-CLIP	21572407
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT510036	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT510035	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510033	hsa-miR-3924	PAR-CLIP	23446348
MIRT522376	hsa-miR-6507-5p	PAR-CLIP	23446348
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506471	hsa-miR-552-5p	PAR-CLIP	23446348
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510036	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT510035	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT510034	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510033	hsa-miR-3924	PAR-CLIP	23446348
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506473	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506472	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506471	hsa-miR-552-5p	PAR-CLIP	23446348
MIRT472666	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT005259	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT472665	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT472664	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT472663	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT472662	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT472661	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT472660	hsa-miR-4506	PAR-CLIP	23592263
MIRT472658	hsa-miR-5571-5p	PAR-CLIP	23592263
MIRT472659	hsa-miR-3908	PAR-CLIP	23592263
MIRT472657	hsa-miR-5002-5p	PAR-CLIP	23592263
MIRT472656	hsa-miR-6515-3p	PAR-CLIP	23592263
MIRT472655	hsa-miR-1236-3p	PAR-CLIP	23592263
MIRT472654	hsa-miR-3140-3p	PAR-CLIP	23592263
MIRT472653	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT472652	hsa-miR-4753-3p	PAR-CLIP	23592263
MIRT472651	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT472650	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT472649	hsa-miR-3122	PAR-CLIP	23592263
MIRT472648	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT472647	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT472646	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT1171603	hsa-miR-101	CLIP-seq
MIRT1171604	hsa-miR-1248	CLIP-seq
MIRT1171605	hsa-miR-1254	CLIP-seq
MIRT1171606	hsa-miR-1261	CLIP-seq
MIRT1171607	hsa-miR-1267	CLIP-seq
MIRT1171608	hsa-miR-1276	CLIP-seq
MIRT1171609	hsa-miR-1279	CLIP-seq
MIRT1171610	hsa-miR-129-5p	CLIP-seq
MIRT1171611	hsa-miR-1305	CLIP-seq
MIRT1171612	hsa-miR-139-5p	CLIP-seq
MIRT1171613	hsa-miR-144	CLIP-seq
MIRT1171614	hsa-miR-148a	CLIP-seq
MIRT1171615	hsa-miR-148b	CLIP-seq
MIRT1171616	hsa-miR-152	CLIP-seq
MIRT1171617	hsa-miR-15a	CLIP-seq
MIRT1171618	hsa-miR-15b	CLIP-seq
MIRT1171619	hsa-miR-16	CLIP-seq
MIRT1171620	hsa-miR-195	CLIP-seq
MIRT1171621	hsa-miR-199a-3p	CLIP-seq
MIRT1171622	hsa-miR-199b-3p	CLIP-seq
MIRT1171623	hsa-miR-2467-3p	CLIP-seq
MIRT1171624	hsa-miR-2681	CLIP-seq
MIRT1171625	hsa-miR-30a	CLIP-seq
MIRT1171626	hsa-miR-30b	CLIP-seq
MIRT1171627	hsa-miR-30c	CLIP-seq
MIRT1171628	hsa-miR-30d	CLIP-seq
MIRT1171629	hsa-miR-30e	CLIP-seq
MIRT1171630	hsa-miR-3116	CLIP-seq
MIRT1171631	hsa-miR-3124-3p	CLIP-seq
MIRT1171632	hsa-miR-3129-5p	CLIP-seq
MIRT1171633	hsa-miR-3152-5p	CLIP-seq
MIRT1171634	hsa-miR-3189-3p	CLIP-seq
MIRT1171635	hsa-miR-3201	CLIP-seq
MIRT1171636	hsa-miR-3607-3p	CLIP-seq
MIRT1171637	hsa-miR-3613-3p	CLIP-seq
MIRT1171638	hsa-miR-3614-3p	CLIP-seq
MIRT1171639	hsa-miR-3667-3p	CLIP-seq
MIRT1171640	hsa-miR-3678-3p	CLIP-seq
MIRT1171641	hsa-miR-3686	CLIP-seq
MIRT1171642	hsa-miR-3691-3p	CLIP-seq
MIRT1171643	hsa-miR-371b-3p	CLIP-seq
MIRT1171644	hsa-miR-3913-3p	CLIP-seq
MIRT1171645	hsa-miR-3919	CLIP-seq
MIRT1171646	hsa-miR-3942-5p	CLIP-seq
MIRT1171647	hsa-miR-424	CLIP-seq
MIRT1171648	hsa-miR-4279	CLIP-seq
MIRT1171649	hsa-miR-4297	CLIP-seq
MIRT1171650	hsa-miR-4426	CLIP-seq
MIRT1171651	hsa-miR-4503	CLIP-seq
MIRT1171652	hsa-miR-4540	CLIP-seq
MIRT1171653	hsa-miR-4641	CLIP-seq
MIRT1171654	hsa-miR-4646-5p	CLIP-seq
MIRT1171655	hsa-miR-4647	CLIP-seq
MIRT1171656	hsa-miR-4652-3p	CLIP-seq
MIRT1171657	hsa-miR-4662b	CLIP-seq
MIRT1171658	hsa-miR-4684-3p	CLIP-seq
MIRT1171659	hsa-miR-4703-5p	CLIP-seq
MIRT1171660	hsa-miR-4747-5p	CLIP-seq
MIRT1171661	hsa-miR-4756-3p	CLIP-seq
MIRT1171662	hsa-miR-4774-3p	CLIP-seq
MIRT1171663	hsa-miR-4775	CLIP-seq
MIRT1171664	hsa-miR-4778-5p	CLIP-seq
MIRT1171665	hsa-miR-4791	CLIP-seq
MIRT1171666	hsa-miR-497	CLIP-seq
MIRT1171667	hsa-miR-498	CLIP-seq
MIRT1171668	hsa-miR-502-5p	CLIP-seq
MIRT1171669	hsa-miR-518a-5p	CLIP-seq
MIRT1171670	hsa-miR-527	CLIP-seq
MIRT1171671	hsa-miR-554	CLIP-seq
MIRT1171672	hsa-miR-587	CLIP-seq
MIRT1171673	hsa-miR-590-3p	CLIP-seq
MIRT1171674	hsa-miR-607	CLIP-seq
MIRT1171675	hsa-miR-622	CLIP-seq
MIRT1171676	hsa-miR-661	CLIP-seq
MIRT1171677	hsa-miR-938	CLIP-seq
MIRT1171603	hsa-miR-101	CLIP-seq
MIRT2049508	hsa-miR-1236	CLIP-seq
MIRT2049509	hsa-miR-1238	CLIP-seq
MIRT1171606	hsa-miR-1261	CLIP-seq
MIRT1171610	hsa-miR-129-5p	CLIP-seq
MIRT1171612	hsa-miR-139-5p	CLIP-seq
MIRT1171613	hsa-miR-144	CLIP-seq
MIRT1171621	hsa-miR-199a-3p	CLIP-seq
MIRT1171622	hsa-miR-199b-3p	CLIP-seq
MIRT1171625	hsa-miR-30a	CLIP-seq
MIRT1171626	hsa-miR-30b	CLIP-seq
MIRT1171627	hsa-miR-30c	CLIP-seq
MIRT1171628	hsa-miR-30d	CLIP-seq
MIRT1171629	hsa-miR-30e	CLIP-seq
MIRT1171632	hsa-miR-3129-5p	CLIP-seq
MIRT2049510	hsa-miR-3160-5p	CLIP-seq
MIRT2049511	hsa-miR-3187-3p	CLIP-seq
MIRT1171634	hsa-miR-3189-3p	CLIP-seq
MIRT1171635	hsa-miR-3201	CLIP-seq
MIRT1171636	hsa-miR-3607-3p	CLIP-seq
MIRT2049512	hsa-miR-3646	CLIP-seq
MIRT2049513	hsa-miR-3662	CLIP-seq
MIRT2049514	hsa-miR-3671	CLIP-seq
MIRT2049515	hsa-miR-3679-3p	CLIP-seq
MIRT1171641	hsa-miR-3686	CLIP-seq
MIRT1171644	hsa-miR-3913-3p	CLIP-seq
MIRT1171645	hsa-miR-3919	CLIP-seq
MIRT2049516	hsa-miR-3938	CLIP-seq
MIRT2049517	hsa-miR-4275	CLIP-seq
MIRT2049518	hsa-miR-4529-5p	CLIP-seq
MIRT2049519	hsa-miR-4672	CLIP-seq
MIRT2049520	hsa-miR-4698	CLIP-seq
MIRT2049521	hsa-miR-4720-3p	CLIP-seq
MIRT1171661	hsa-miR-4756-3p	CLIP-seq
MIRT1171663	hsa-miR-4775	CLIP-seq
MIRT1171665	hsa-miR-4791	CLIP-seq
MIRT2049522	hsa-miR-4804-3p	CLIP-seq
MIRT1171668	hsa-miR-502-5p	CLIP-seq
MIRT2049523	hsa-miR-544	CLIP-seq
MIRT1171673	hsa-miR-590-3p	CLIP-seq
MIRT1171674	hsa-miR-607	CLIP-seq
MIRT1171675	hsa-miR-622	CLIP-seq
MIRT1171603	hsa-miR-101	CLIP-seq
MIRT2278431	hsa-miR-125a-3p	CLIP-seq
MIRT2278432	hsa-miR-1265	CLIP-seq
MIRT2278433	hsa-miR-1273d	CLIP-seq
MIRT1171608	hsa-miR-1276	CLIP-seq
MIRT2278434	hsa-miR-1299	CLIP-seq
MIRT1171611	hsa-miR-1305	CLIP-seq
MIRT1171612	hsa-miR-139-5p	CLIP-seq
MIRT2278435	hsa-miR-140-3p	CLIP-seq
MIRT1171613	hsa-miR-144	CLIP-seq
MIRT1171617	hsa-miR-15a	CLIP-seq
MIRT1171618	hsa-miR-15b	CLIP-seq
MIRT1171619	hsa-miR-16	CLIP-seq
MIRT1171620	hsa-miR-195	CLIP-seq
MIRT1171621	hsa-miR-199a-3p	CLIP-seq
MIRT1171622	hsa-miR-199b-3p	CLIP-seq
MIRT2278436	hsa-miR-205	CLIP-seq
MIRT2278437	hsa-miR-217	CLIP-seq
MIRT2278438	hsa-miR-2392	CLIP-seq
MIRT2278439	hsa-miR-3074-3p	CLIP-seq
MIRT1171625	hsa-miR-30a	CLIP-seq
MIRT1171626	hsa-miR-30b	CLIP-seq
MIRT1171627	hsa-miR-30c	CLIP-seq
MIRT1171628	hsa-miR-30d	CLIP-seq
MIRT1171629	hsa-miR-30e	CLIP-seq
MIRT1171631	hsa-miR-3124-3p	CLIP-seq
MIRT1171632	hsa-miR-3129-5p	CLIP-seq
MIRT2278440	hsa-miR-3177-5p	CLIP-seq
MIRT1171636	hsa-miR-3607-3p	CLIP-seq
MIRT1171637	hsa-miR-3613-3p	CLIP-seq
MIRT2278441	hsa-miR-361-5p	CLIP-seq
MIRT2049514	hsa-miR-3671	CLIP-seq
MIRT1171641	hsa-miR-3686	CLIP-seq
MIRT2278442	hsa-miR-3915	CLIP-seq
MIRT2278443	hsa-miR-3928	CLIP-seq
MIRT2278444	hsa-miR-3973	CLIP-seq
MIRT2278445	hsa-miR-3974	CLIP-seq
MIRT1171647	hsa-miR-424	CLIP-seq
MIRT2278446	hsa-miR-4264	CLIP-seq
MIRT2278447	hsa-miR-4277	CLIP-seq
MIRT1171648	hsa-miR-4279	CLIP-seq
MIRT2278448	hsa-miR-4300	CLIP-seq
MIRT2278449	hsa-miR-4328	CLIP-seq
MIRT2278450	hsa-miR-4450	CLIP-seq
MIRT2278451	hsa-miR-4476	CLIP-seq
MIRT2278452	hsa-miR-4480	CLIP-seq
MIRT2278453	hsa-miR-450b-3p	CLIP-seq
MIRT2278454	hsa-miR-4648	CLIP-seq
MIRT2278455	hsa-miR-4654	CLIP-seq
MIRT2278456	hsa-miR-4661-3p	CLIP-seq
MIRT2278457	hsa-miR-4695-3p	CLIP-seq
MIRT2049521	hsa-miR-4720-3p	CLIP-seq
MIRT2278458	hsa-miR-4738-3p	CLIP-seq
MIRT2278459	hsa-miR-4769-5p	CLIP-seq
MIRT1171663	hsa-miR-4775	CLIP-seq
MIRT2278460	hsa-miR-4781-3p	CLIP-seq
MIRT2278461	hsa-miR-4782-5p	CLIP-seq
MIRT2278462	hsa-miR-4797-3p	CLIP-seq
MIRT2049522	hsa-miR-4804-3p	CLIP-seq
MIRT1171666	hsa-miR-497	CLIP-seq
MIRT2278463	hsa-miR-516b	CLIP-seq
MIRT2278464	hsa-miR-520g	CLIP-seq
MIRT2278465	hsa-miR-520h	CLIP-seq
MIRT2278466	hsa-miR-562	CLIP-seq
MIRT2278467	hsa-miR-568	CLIP-seq
MIRT2278468	hsa-miR-586	CLIP-seq
MIRT1171673	hsa-miR-590-3p	CLIP-seq
MIRT1171674	hsa-miR-607	CLIP-seq
MIRT1171675	hsa-miR-622	CLIP-seq
MIRT2278469	hsa-miR-651	CLIP-seq
MIRT2278470	hsa-miR-769-3p	CLIP-seq
MIRT2278471	hsa-miR-920	CLIP-seq
MIRT2278472	hsa-miR-936	CLIP-seq
MIRT2278439	hsa-miR-3074-3p	CLIP-seq
MIRT1171631	hsa-miR-3124-3p	CLIP-seq
MIRT2278449	hsa-miR-4328	CLIP-seq
MIRT2278439	hsa-miR-3074-3p	CLIP-seq
MIRT1171631	hsa-miR-3124-3p	CLIP-seq
MIRT2278449	hsa-miR-4328	CLIP-seq
MIRT2576807	hsa-miR-1224-5p	CLIP-seq
MIRT2576808	hsa-miR-125a-5p	CLIP-seq
MIRT2576809	hsa-miR-125b	CLIP-seq
MIRT2278432	hsa-miR-1265	CLIP-seq
MIRT2576810	hsa-miR-1324	CLIP-seq
MIRT2278438	hsa-miR-2392	CLIP-seq
MIRT2576811	hsa-miR-302a	CLIP-seq
MIRT2576812	hsa-miR-302b	CLIP-seq
MIRT2576813	hsa-miR-302c	CLIP-seq
MIRT2576814	hsa-miR-302d	CLIP-seq
MIRT2576815	hsa-miR-302e	CLIP-seq
MIRT2576816	hsa-miR-3202	CLIP-seq
MIRT2576817	hsa-miR-342-3p	CLIP-seq
MIRT2278441	hsa-miR-361-5p	CLIP-seq
MIRT2576818	hsa-miR-3621	CLIP-seq
MIRT2576819	hsa-miR-3656	CLIP-seq
MIRT1171642	hsa-miR-3691-3p	CLIP-seq
MIRT2576820	hsa-miR-372	CLIP-seq
MIRT2576821	hsa-miR-373	CLIP-seq
MIRT2576822	hsa-miR-374a	CLIP-seq
MIRT2576823	hsa-miR-374b	CLIP-seq
MIRT2576824	hsa-miR-4319	CLIP-seq
MIRT2278450	hsa-miR-4450	CLIP-seq
MIRT2576825	hsa-miR-448	CLIP-seq
MIRT2576826	hsa-miR-4533	CLIP-seq
MIRT2576827	hsa-miR-4662a-5p	CLIP-seq
MIRT2576828	hsa-miR-4732-3p	CLIP-seq
MIRT2576829	hsa-miR-4751	CLIP-seq
MIRT2576830	hsa-miR-515-3p	CLIP-seq
MIRT2576831	hsa-miR-519a	CLIP-seq
MIRT2576832	hsa-miR-519b-3p	CLIP-seq
MIRT2576833	hsa-miR-519c-3p	CLIP-seq
MIRT2576834	hsa-miR-519e	CLIP-seq
MIRT2576835	hsa-miR-520a-3p	CLIP-seq
MIRT2576836	hsa-miR-520b	CLIP-seq
MIRT2576837	hsa-miR-520c-3p	CLIP-seq
MIRT2576838	hsa-miR-520d-3p	CLIP-seq
MIRT2576839	hsa-miR-520e	CLIP-seq
MIRT2576840	hsa-miR-544b	CLIP-seq
MIRT2576841	hsa-miR-548ae	CLIP-seq
MIRT2576842	hsa-miR-548aj	CLIP-seq
MIRT2576843	hsa-miR-548am	CLIP-seq
MIRT2576844	hsa-miR-548x	CLIP-seq
MIRT2576845	hsa-miR-550a	CLIP-seq
MIRT2576846	hsa-miR-670	CLIP-seq
MIRT1171677	hsa-miR-938	CLIP-seq
MIRT2576807	hsa-miR-1224-5p	CLIP-seq
MIRT2576808	hsa-miR-125a-5p	CLIP-seq
MIRT2576809	hsa-miR-125b	CLIP-seq
MIRT2278432	hsa-miR-1265	CLIP-seq
MIRT2278438	hsa-miR-2392	CLIP-seq
MIRT2576811	hsa-miR-302a	CLIP-seq
MIRT2576812	hsa-miR-302b	CLIP-seq
MIRT2576813	hsa-miR-302c	CLIP-seq
MIRT2576814	hsa-miR-302d	CLIP-seq
MIRT2576815	hsa-miR-302e	CLIP-seq
MIRT2576817	hsa-miR-342-3p	CLIP-seq
MIRT1171642	hsa-miR-3691-3p	CLIP-seq
MIRT2576820	hsa-miR-372	CLIP-seq
MIRT2576821	hsa-miR-373	CLIP-seq
MIRT2576824	hsa-miR-4319	CLIP-seq
MIRT2278450	hsa-miR-4450	CLIP-seq
MIRT2576827	hsa-miR-4662a-5p	CLIP-seq
MIRT2576828	hsa-miR-4732-3p	CLIP-seq
MIRT2576829	hsa-miR-4751	CLIP-seq
MIRT2576830	hsa-miR-515-3p	CLIP-seq
MIRT2576831	hsa-miR-519a	CLIP-seq
MIRT2576832	hsa-miR-519b-3p	CLIP-seq
MIRT2576833	hsa-miR-519c-3p	CLIP-seq
MIRT2576834	hsa-miR-519e	CLIP-seq
MIRT2576835	hsa-miR-520a-3p	CLIP-seq
MIRT2576836	hsa-miR-520b	CLIP-seq
MIRT2576837	hsa-miR-520c-3p	CLIP-seq
MIRT2576838	hsa-miR-520d-3p	CLIP-seq
MIRT2576839	hsa-miR-520e	CLIP-seq
MIRT2576840	hsa-miR-544b	CLIP-seq
MIRT2576841	hsa-miR-548ae	CLIP-seq
MIRT2576842	hsa-miR-548aj	CLIP-seq
MIRT2576843	hsa-miR-548am	CLIP-seq
MIRT2576844	hsa-miR-548x	CLIP-seq
MIRT2576845	hsa-miR-550a	CLIP-seq
MIRT2576846	hsa-miR-670	CLIP-seq
MIRT1171677	hsa-miR-938	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18570629, 34230638
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18570629
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0010698	Function	Acetyltransferase activator activity	IBA
GO:0031416	Component	NatB complex	IBA
GO:0031416	Component	NatB complex	IPI	18570629

MIM	HGNC	e!Ensembl
612755	25783	ENSG00000111300

Q14CX7

Protein name

N-alpha-acetyltransferase 25, NatB auxiliary subunit (Mitochondrial distribution and morphology protein 20) (N-terminal acetyltransferase B complex subunit MDM20) (NatB complex subunit MDM20) (N-terminal acetyltransferase B complex subunit NAA25) (p120)

Protein function

Non-catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. May play a role in normal cell-cycle progression. {ECO:0000269|PubMed:1

PDB

6VP9 , 7STX , 8G0L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09797	NatB_MDM20	263 → 658	N-acetyltransferase B complex (NatB) non catalytic subunit	Family

Sequence

MATRGHVQDPNDRRLRPIYDYLDNGNNKMAIQQADKLLKKHKDLHCAKVLKAIGLQRTGK
QEEAFTLAQEVAALEPTDDNSLQALTILYREMHRPELVTKLYEAAVKKVPNSEEYHSHLF
MAYARVGEYKKMQQAGMALYKIVPKNPYYFWSVMSLIMQSISAQDENLSKTMFLPLAERM
VEKMVKEDKIEAEAEVELYYMILERLGKYQEALDVIRGKLGEKLTSEIQSRENKCMAMYK
KLSRWPECNALSRRLLLKNSDDWQFYLTYFDSVFRLIEEAWSPPAEGEHSLEGEVHYSAE
KAVKFIEDRITEESKSSRHLRGPHLAKLELIRRLRSQGCNDEYKLGDPEELMFQYFKKFG
DKPCCFTDLKVFVDLLPATQCTKFINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQL
TRLLGLYHTMDKNQKLSVVRELMLRYQHGLEFGKTCLKTELQFSDYYCLLAVHALIDVWR
ETGDETTVWQALTLLEEGLTHSPSNAQFKLLLVRIYCMLGAFEPVVDLYSSLDAKHIQHD
TIGYLLTRYAESLGQYAAASQSCNFALRFFHSNQKDTSEYIIQAYKYGAFEKIPEFIAFR
NRLNNSLHFAQVRTERMLLDLLLEANISTSLAESIKSMNLRPEEDDIPWEDLRDNRDLNV
FFSWDPKDRDVSEEHKKLSLEEETLWLRIRSLTLRLISGLPSLNHPVEPKNSEKTAENGV
SSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLV
NDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLEN
LVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTL
ISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELL
KKRLETTKKLKI

Sequence length

972

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALISED EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK MALIGNANT NEOPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTIAL EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (68)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31352174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	19565500, 20722033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20722033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31352174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19565500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19565500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20550696, 20595387, 28779344, 7829252, 8443798		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	34018994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CAPILLARY MALFORMATION-ARTERIOVENOUS MALFORMATION (disorder)	Capillary Malformation-Arteriovenous Malformation	BEFREE	28530642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	18216211, 19081526, 19755166, 21487764, 24213847, 25782900, 28125650, 28501926, 28645479, 29174729, 29846557, 30052178, 30170546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASDB_DG	24262325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	24262325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31352174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28969027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	24262325		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	30104761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21971053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20722033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	20089178, 20722033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17554260, 17554300, 18978792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	17554260, 17554300, 18978792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	19168599, 20089178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	21437268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	23347178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	23347178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	29879492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28464297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28464297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28464297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28464297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31440166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31440166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10024672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	GWASCAT_DG	21437268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	GWASDB_DG	21437268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoalphalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	29879492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASDB_DG	22493691		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28779344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30656483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	19565500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10365117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	23286385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19565500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20595387, 28779344, 8443798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28464297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12492499, 20943860, 23950111, 28969027, 8287366, 8443798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28969027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	20550696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	20722033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11889215, 12492499, 12671892, 14610055, 23950111, 8287366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30867003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	19565500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	18560202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	1711550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19565500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	9815576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28464297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22052802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	GWASDB_DG	23297363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thiel-Behnke corneal dystrophy	Thiel-Behnke Corneal Dystrophy	BEFREE	28125650		★★★★★ ★☆☆☆☆ Found in Text Mining only

NAA25 (N-alpha-acetyltransferase 25, NatB auxiliary subunit)