Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	8001
Gene name	Glycine receptor alpha 3
Gene symbol	GLRA3
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q34.1
Summary	This gene encodes a member of the ligand-gated ion channel protein family. The encoded protein is a member of the glycine receptor subfamily. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]

Show/Hide all (54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT688096	hsa-miR-4311	HITS-CLIP	23313552
MIRT688095	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT688094	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688093	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT490501	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT490502	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT490500	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT490499	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490498	hsa-miR-9500	PAR-CLIP	23592263
MIRT490497	hsa-miR-5681a	PAR-CLIP	23592263
MIRT490496	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT490495	hsa-miR-4770	PAR-CLIP	23592263
MIRT490494	hsa-miR-6088	PAR-CLIP	23592263
MIRT490493	hsa-miR-6077	PAR-CLIP	23592263
MIRT490492	hsa-miR-3153	PAR-CLIP	23592263
MIRT490490	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490491	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT688096	hsa-miR-4311	HITS-CLIP	23313552
MIRT688095	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT688094	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688093	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT490501	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT490502	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT490500	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT490499	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490498	hsa-miR-9500	PAR-CLIP	23592263
MIRT490497	hsa-miR-5681a	PAR-CLIP	23592263
MIRT490496	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT490495	hsa-miR-4770	PAR-CLIP	23592263
MIRT490494	hsa-miR-6088	PAR-CLIP	23592263
MIRT490493	hsa-miR-6077	PAR-CLIP	23592263
MIRT490492	hsa-miR-3153	PAR-CLIP	23592263
MIRT490490	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490491	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT1021428	hsa-miR-1264	CLIP-seq
MIRT1021429	hsa-miR-155	CLIP-seq
MIRT1021430	hsa-miR-3662	CLIP-seq
MIRT1021431	hsa-miR-4652-3p	CLIP-seq
MIRT1021432	hsa-miR-759	CLIP-seq
MIRT2002656	hsa-miR-4680-5p	CLIP-seq
MIRT2002657	hsa-miR-4799-5p	CLIP-seq
MIRT2002658	hsa-miR-561	CLIP-seq
MIRT2235631	hsa-miR-19a	CLIP-seq
MIRT2235632	hsa-miR-19b	CLIP-seq
MIRT2235633	hsa-miR-297	CLIP-seq
MIRT2235634	hsa-miR-3119	CLIP-seq
MIRT2235635	hsa-miR-3140-3p	CLIP-seq
MIRT2235636	hsa-miR-3149	CLIP-seq
MIRT2235637	hsa-miR-3200-5p	CLIP-seq
MIRT2235638	hsa-miR-4282	CLIP-seq
MIRT2235639	hsa-miR-4682	CLIP-seq
MIRT2388506	hsa-miR-374c	CLIP-seq
MIRT2388507	hsa-miR-4666-3p	CLIP-seq
MIRT2388508	hsa-miR-655	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005886	Component	Plasma membrane	IDA	26416729
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	9677400
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016594	Function	Glycine binding	IEA
GO:0016934	Function	Extracellularly glycine-gated chloride channel activity	IDA	26416729
GO:0016934	Function	Extracellularly glycine-gated chloride channel activity	IEA
GO:0016935	Component	Glycine-gated chloride channel complex	IDA	9677400
GO:0022824	Function	Transmitter-gated monoatomic ion channel activity	IEA
GO:0022852	Function	Glycine-gated chloride ion channel activity	IDA	9677400
GO:0030425	Component	Dendrite	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051260	Process	Protein homooligomerization	IDA	26416729
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098690	Component	Glycinergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA
GO:1902476	Process	Chloride transmembrane transport	IDA	9677400

MIM	HGNC	e!Ensembl
600421	4328	ENSG00000145451

O75311

Protein name

Glycine receptor subunit alpha-3

Protein function

Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine (PubMed:26416729, PubMed:9677400). Channel characteristics depend on the subunit composition; heteropentameric channels display faster ch

PDB

5CFB , 5TIN , 5TIO , 5VDH , 5VDI , 9BU2 , 9BU3 , 9BVH , 9BVJ , 9BWB , 9BWC , 9BWE , 9BWG , 9BWJ , 9BZP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	43 → 253	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	260 → 382	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Widely distributed throughout the central nervous system. {ECO:0000269|PubMed:9677400}.

Sequence

MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD

Sequence length

464

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Neurotransmitter receptors and postsynaptic signal transmission

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, OVARIAN EPITHELIAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis, Gouty	Gouty arthritis	BEFREE	30467477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15090072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	15090072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	CTD_human_DG	28811376		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36949158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	24595857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30120300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36949158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	20188170, 27839871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	11496371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	19723286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperekplexia	Hyperekplexia	Pubtator	28174298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperexplexia hereditary	Hyperexplexia hereditary	Pubtator	28174298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	11496371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27839871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16822851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	GWASCAT_DG	25963547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29155210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	GWASCAT_DG	25963547		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25963547	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rett Syndrome	Rett Syndrome	BEFREE	29203410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	20518839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16822851		★★★★★ ★☆☆☆☆ Found in Text Mining only

GLRA3 (glycine receptor alpha 3)