WLS (Wnt ligand secretion mediator)

Gene

• Entrez ID: 79971
• Gene name: Wnt ligand secretion mediator
• Gene symbol: WLS
• Synonyms (NCBI Gene): C1orf139, EVI, GPR177, MRP, ZKS, mig-14
• Chromosome: 1
• Chromosome location: 1p31.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023503	hsa-miR-1-3p	Proteomics	18668040
MIRT028895	hsa-miR-26b-5p	Microarray	19088304
MIRT032212	hsa-let-7b-5p	Proteomics	18668040
MIRT044935	hsa-miR-186-5p	CLASH	23622248
MIRT531926	hsa-miR-4678	PAR-CLIP	22012620
MIRT531925	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT531923	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT531924	hsa-miR-331-5p	PAR-CLIP	22012620
MIRT737281	hsa-miR-31-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33007980
MIRT531926	hsa-miR-4678	PAR-CLIP	22012620
MIRT531925	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT531923	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT531924	hsa-miR-331-5p	PAR-CLIP	22012620
MIRT1493270	hsa-miR-1827	CLIP-seq
MIRT1493271	hsa-miR-579	CLIP-seq
MIRT1493272	hsa-miR-664	CLIP-seq
MIRT1493273	hsa-miR-1286	CLIP-seq
MIRT1493274	hsa-miR-4691-5p	CLIP-seq
MIRT1493275	hsa-miR-4722-5p	CLIP-seq
MIRT2148721	hsa-miR-140-3p	CLIP-seq
MIRT2463508	hsa-miR-3646	CLIP-seq
MIRT2463509	hsa-miR-3659	CLIP-seq
MIRT2463510	hsa-miR-4484	CLIP-seq
MIRT2463511	hsa-miR-4658	CLIP-seq
MIRT2463512	hsa-miR-548an	CLIP-seq
MIRT2463513	hsa-miR-574-5p	CLIP-seq
MIRT2463514	hsa-miR-577	CLIP-seq
MIRT2463508	hsa-miR-3646	CLIP-seq
MIRT2463509	hsa-miR-3659	CLIP-seq
MIRT2463510	hsa-miR-4484	CLIP-seq
MIRT2463511	hsa-miR-4658	CLIP-seq
MIRT2463512	hsa-miR-548an	CLIP-seq
MIRT2463513	hsa-miR-574-5p	CLIP-seq
MIRT2463514	hsa-miR-577	CLIP-seq
MIRT2662694	hsa-miR-1184	CLIP-seq
MIRT2662695	hsa-miR-1226	CLIP-seq
MIRT2662696	hsa-miR-1265	CLIP-seq
MIRT2662697	hsa-miR-1269	CLIP-seq
MIRT2662698	hsa-miR-1269b	CLIP-seq
MIRT2662699	hsa-miR-1288	CLIP-seq
MIRT2148721	hsa-miR-140-3p	CLIP-seq
MIRT1493270	hsa-miR-1827	CLIP-seq
MIRT2662700	hsa-miR-185	CLIP-seq
MIRT2662701	hsa-miR-3128	CLIP-seq
MIRT2662702	hsa-miR-3136-3p	CLIP-seq
MIRT2662703	hsa-miR-3148	CLIP-seq
MIRT2662704	hsa-miR-3184	CLIP-seq
MIRT2662705	hsa-miR-3200-3p	CLIP-seq
MIRT2662706	hsa-miR-326	CLIP-seq
MIRT2662707	hsa-miR-330-5p	CLIP-seq
MIRT2662708	hsa-miR-361-3p	CLIP-seq
MIRT2662709	hsa-miR-3622b-5p	CLIP-seq
MIRT2662710	hsa-miR-3649	CLIP-seq
MIRT2662711	hsa-miR-3670	CLIP-seq
MIRT2662712	hsa-miR-3671	CLIP-seq
MIRT2662713	hsa-miR-423-5p	CLIP-seq
MIRT2662714	hsa-miR-4286	CLIP-seq
MIRT2662715	hsa-miR-4306	CLIP-seq
MIRT2662716	hsa-miR-4436b-5p	CLIP-seq
MIRT2662717	hsa-miR-4492	CLIP-seq
MIRT2662718	hsa-miR-4498	CLIP-seq
MIRT2662719	hsa-miR-4505	CLIP-seq
MIRT2662720	hsa-miR-4515	CLIP-seq
MIRT2662721	hsa-miR-4529-3p	CLIP-seq
MIRT2662722	hsa-miR-4644	CLIP-seq
MIRT2662723	hsa-miR-4665-3p	CLIP-seq
MIRT2662724	hsa-miR-4668-3p	CLIP-seq
MIRT2662725	hsa-miR-4720-5p	CLIP-seq
MIRT2662726	hsa-miR-4731-5p	CLIP-seq
MIRT2662727	hsa-miR-4740-5p	CLIP-seq
MIRT2662728	hsa-miR-4799-3p	CLIP-seq
MIRT2662729	hsa-miR-4802-5p	CLIP-seq
MIRT1493271	hsa-miR-579	CLIP-seq
MIRT2662730	hsa-miR-592	CLIP-seq
MIRT2662731	hsa-miR-597	CLIP-seq
MIRT1493272	hsa-miR-664	CLIP-seq
MIRT2662732	hsa-miR-668	CLIP-seq
MIRT2662733	hsa-miR-762	CLIP-seq
MIRT2662734	hsa-miR-877	CLIP-seq
MIRT2662695	hsa-miR-1226	CLIP-seq
MIRT2662696	hsa-miR-1265	CLIP-seq
MIRT2662697	hsa-miR-1269	CLIP-seq
MIRT2662698	hsa-miR-1269b	CLIP-seq
MIRT2662699	hsa-miR-1288	CLIP-seq
MIRT2148721	hsa-miR-140-3p	CLIP-seq
MIRT1493270	hsa-miR-1827	CLIP-seq
MIRT2662700	hsa-miR-185	CLIP-seq
MIRT2662701	hsa-miR-3128	CLIP-seq
MIRT2662702	hsa-miR-3136-3p	CLIP-seq
MIRT2662703	hsa-miR-3148	CLIP-seq
MIRT2662704	hsa-miR-3184	CLIP-seq
MIRT2662705	hsa-miR-3200-3p	CLIP-seq
MIRT2662706	hsa-miR-326	CLIP-seq
MIRT2662707	hsa-miR-330-5p	CLIP-seq
MIRT2662708	hsa-miR-361-3p	CLIP-seq
MIRT2662709	hsa-miR-3622b-5p	CLIP-seq
MIRT2662710	hsa-miR-3649	CLIP-seq
MIRT2662711	hsa-miR-3670	CLIP-seq
MIRT2662712	hsa-miR-3671	CLIP-seq
MIRT2662713	hsa-miR-423-5p	CLIP-seq
MIRT2662714	hsa-miR-4286	CLIP-seq
MIRT2662715	hsa-miR-4306	CLIP-seq
MIRT2662716	hsa-miR-4436b-5p	CLIP-seq
MIRT2662717	hsa-miR-4492	CLIP-seq
MIRT2662718	hsa-miR-4498	CLIP-seq
MIRT2662719	hsa-miR-4505	CLIP-seq
MIRT2662720	hsa-miR-4515	CLIP-seq
MIRT2662721	hsa-miR-4529-3p	CLIP-seq
MIRT2662722	hsa-miR-4644	CLIP-seq
MIRT2662723	hsa-miR-4665-3p	CLIP-seq
MIRT2662724	hsa-miR-4668-3p	CLIP-seq
MIRT2662725	hsa-miR-4720-5p	CLIP-seq
MIRT2662726	hsa-miR-4731-5p	CLIP-seq
MIRT2662727	hsa-miR-4740-5p	CLIP-seq
MIRT2662728	hsa-miR-4799-3p	CLIP-seq
MIRT2662729	hsa-miR-4802-5p	CLIP-seq
MIRT1493271	hsa-miR-579	CLIP-seq
MIRT2662730	hsa-miR-592	CLIP-seq
MIRT2662731	hsa-miR-597	CLIP-seq
MIRT1493272	hsa-miR-664	CLIP-seq
MIRT2662732	hsa-miR-668	CLIP-seq
MIRT2662733	hsa-miR-762	CLIP-seq
MIRT2662734	hsa-miR-877	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	24768165
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001707	Process	Mesoderm formation	IEA
GO:0005515	Function	Protein binding	IPI	18160348, 20214800, 22784633, 23840749, 24768165, 28298427, 28734904, 31286866, 33961781
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	18160348
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	24768165
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	16678095
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	18160348
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	18160348, 24768165
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	IMP	16678095
GO:0009948	Process	Anterior/posterior axis specification	IEA
GO:0009948	Process	Anterior/posterior axis specification	ISS
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	IPI	24768165
GO:0017147	Function	Wnt-protein binding	ISS	16678095
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IMP	16678095, 16678096
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030901	Process	Midbrain development	IEA
GO:0030902	Process	Hindbrain development	IEA
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031090	Component	Organelle membrane	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	16678095, 24768165
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0042802	Function	Identical protein binding	IPI	28734904
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0061355	Process	Wnt protein secretion	IBA
GO:0061355	Process	Wnt protein secretion	IEA
GO:0061355	Process	Wnt protein secretion	IMP	24768165
GO:0061357	Process	Positive regulation of Wnt protein secretion	IMP	16678095
GO:0061357	Process	Positive regulation of Wnt protein secretion	ISS	16678096
GO:0070062	Component	Extracellular exosome	TAS
GO:0071529	Process	Cementum mineralization	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	17804805

Other IDs

• MIM: 611514
• HGNC: 30238
• e!Ensembl: ENSG00000116729

Protein

• UniProt ID: Q5T9L3
• Protein name: Protein wntless homolog (Integral membrane protein GPR177) (Protein evenness interrupted homolog) (EVI) (Putative NF-kappa-B-activating protein 373)
• Protein function: Regulates Wnt proteins sorting and secretion in a feedback regulatory mechanism. This reciprocal interaction plays a key role in the regulation of expression, subcellular location, binding and organelle-specific association of Wnt proteins (PubM
• PDB: 7DRT, 7KC4, 8TZO, 8TZP, 8TZR, 8TZS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06664	MIG-14_Wnt-bd	178 → 496		Family

• Sequence:

  MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKT
  KWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAF
  KLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECD
  VLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTF
  LTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFG
  DIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQ
  LTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV
  RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGM
  WNLYVFALMFLYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQ
  E

• Sequence length: 541

Pathways

Reactome:

WNT ligand biogenesis and trafficking

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
WLS syndrome	Likely pathogenic; Pathogenic	rs773311381, rs2100377758, rs985347096, rs2100452147	RCV001420504 RCV001420503 RCV001420502 RCV001420501	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Zaki syndrome	Likely pathogenic; Pathogenic	rs773311381, rs2100377758, rs985347096, rs2100452147	RCV001788474 RCV001788473 RCV001789704 RCV001788472	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WLS-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	16614510, 7808005		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11849207, 15543372, 25115440, 7528566, 7808005, 7911548, 7914748		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	7528566, 9815827		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	7528566		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	7669560		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	7903701, 8603824		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11929704		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	10533474		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	7914748		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	17340137, 8558937, 9616142		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18473730		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	11206006		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11206006, 18462887, 22147553		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21956908, 30021380		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	11466205		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	7803281		★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	18226047		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27748815, 8980253		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	8656699		★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	17701897		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10678554		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	9514046, 9626474, 9666517, 9816292		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25258105	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	10762632		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11712788, 18226047, 8603824, 8766528, 8980253		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27748815		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	8467491, 8647646, 9014757, 9272120, 9334814, 9413193, 9713512		★☆☆☆☆ Found in Text Mining only
Cartilage-hair hypoplasia	Cartilage-Hair Hypoplasia	BEFREE	12107819, 18164267, 21053045, 21956908, 24009312, 28115465		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15543372, 7914748		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	17340137, 30813931, 8558937		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18473730		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18226047		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29526886	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11908721, 7803281, 7911548, 9722297, 9815925		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12370750, 9045962		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10533474, 8603824, 8705999, 9010028		★☆☆☆☆ Found in Text Mining only
Congenital absence of vas deferens	Absent vas deferens	BEFREE	11466205		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8980253, 9700723		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26512113	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16167518		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11712788, 8847137		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	8637212		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	8637212		★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	31776782		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31272718		★☆☆☆☆ Found in Text Mining only
Genital Neoplasms, Female	Genital Neoplasms, Female	BEFREE	11712788		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	11045339		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11206006, 18443953, 18462887		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29990993	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18443953, 18462887		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10832087, 11206006, 22147553, 7640227, 9345268		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29990993	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	7803281		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15560070, 9815925		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	8062263		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	15560070		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31097431		★☆☆☆☆ Found in Text Mining only
Jaundice, Chronic Idiopathic	Jaundice	BEFREE	8621134		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	15908146		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	7803281, 7911548, 7911871, 8575859, 8833393, 9616142, 9649117		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28114350	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10050716, 10374860, 10695821, 11587212, 11726321, 12962366, 17340137, 17693189, 25331116, 7528566, 7564506, 7808005, 7911548, 8062263, 8558937, 8642857, 9031075, 9168435, 9204993, 9338618, 9459150, 9616142, 9808049, 9815827, 9815890, 9815925		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	10210147		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10081488, 11354286, 12623109, 14599947, 26985715		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10081488		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	7833148		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29526886	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15560070, 9160686		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	7803281, 9722297		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	7803281		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	9722297		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	9666517, 9816292		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	8847137		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	8637212		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	8637212		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15112342		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15342407, 8467491, 8647646, 9014757, 9272120, 9334814, 9413193, 9569044, 9713512		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	10762632		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10792001, 11078791		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11205224, 19930704, 29555015		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25590838		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27748815		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15560070, 17701897, 18443953, 18462887, 19240161, 19442050, 21740521, 27636860, 7640227, 7803281, 8647646, 8833393, 8980253, 9378536, 9666517		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12370750, 9045962		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	9514046		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10894369, 18473730		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11298532		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11595715, 9495245		★☆☆☆☆ Found in Text Mining only
Metaphyseal chondrodysplasia Schmid type	Metaphyseal chondrodysplasia	BEFREE	14569119		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	15908146		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22434582, 7803281, 8062263, 8833393		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	7911548		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10762632, 25586348		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10037101, 10081488, 10427140, 10690550, 10999764, 14599947, 15112342, 15543372, 20093746, 25551557, 7803281, 7923112, 8532000, 8647646, 8705999, 8980253, 9010028, 9081396, 9160686, 9359705, 9516848, 9569044, 9816292		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	29790264		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	10736562		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10081488, 10348353, 10425316, 7923112, 8532000, 9516823, 9516848		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	10894369		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27268921, 7669560, 8467491, 8603824, 8647646, 9081396, 9334814		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	11466205		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	21645651		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29057911		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	25551557		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25551557	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	8603381		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25258105	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15688370		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23416978	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	11929704		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	15543372, 25115440, 7911548		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12763363		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10792001, 11078791		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35131873	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15654950		★☆☆☆☆ Found in Text Mining only
Pyle metaphyseal dysplasia	Pyle Metaphyseal Dysplasia	BEFREE	23643676		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8683726, 8980253, 9700723		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	14654923		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	20047843, 8467491, 8980384, 9377550, 9413193		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	10953346		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	7669560, 8603824, 9081396		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10744048		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11205224, 19930704, 29555015		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18972317		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	8980253		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25590838		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25590838		★☆☆☆☆ Found in Text Mining only