PAQR6 (progestin and adipoQ receptor family member 6)

Gene

• Entrez ID: 79957
• Gene name: Progestin and adipoQ receptor family member 6
• Gene symbol: PAQR6
• Synonyms (NCBI Gene): PRdelta
• Chromosome: 1
• Chromosome location: 1q22

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018303	hsa-miR-335-5p	Microarray	18185580
MIRT029764	hsa-miR-26b-5p	Microarray	19088304
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213503	hsa-miR-1912	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq
MIRT1213507	hsa-miR-501-3p	CLIP-seq
MIRT1213508	hsa-miR-502-3p	CLIP-seq
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq
MIRT2061462	hsa-miR-3180-5p	CLIP-seq
MIRT2061463	hsa-miR-520a-5p	CLIP-seq
MIRT2061464	hsa-miR-525-5p	CLIP-seq
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA

Other IDs

• MIM: 614579
• HGNC: 30132
• e!Ensembl: ENSG00000160781

Protein

• UniProt ID: Q6TCH4
• Protein name: Membrane progestin receptor delta (mPR delta) (Membrane progesterone P4 receptor delta) (Membrane progesterone receptor delta) (Progesterone and adipoQ receptor family member 6) (Progestin and adipoQ receptor family member 6)
• Protein function: Plasma membrane progesterone (P4) receptor coupled to G proteins (PubMed:23161870, PubMed:23763432). Seems to act through a G(s) mediated pathway (PubMed:23161870). Involved in neurosteroid inhibition of apoptosis (PubMed:23161870). May be invol
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03006	HlyIII	43 → 272	Haemolysin-III related	Family

• Tissue specificity: TISSUE SPECIFICITY: Brain specific (PubMed:16044242, PubMed:23763432). Highly expressed in the hypothalamus, also expressed in forebrain, amygdala, corpus callosum and spinal cord (PubMed:23161870). {ECO:0000269|PubMed:16044242, ECO:0000269|PubMed:2316187
• Sequence:

  MLSLKLPQLLQVHQVPRVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTW
  YFLWRLLALAGGPGFRAEPYHWPLLVFLLPACLYPFASCCAHTFSSMSPRMRHICYFLDY
  GALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPAAALNSFLCTGLSCYSRFLELESPGL
  SKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHLFCALLTGFLFASH
  LPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGLAGTVA
  TLVLAAAGNLLIIAAFTATLLRAPSTCPLLQGGPLEGGTQAKQQ

• Sequence length: 344

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
NEPHROLITHIASIS, CALCIUM OXALATE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	36544231	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39742277	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32733932	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	32733932	Associate	★☆☆☆☆ Found in Text Mining only
NEPHROLITHIASIS, CALCIUM OXALATE	Nephronophthisis	CLINVAR_DG	24886237		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	40383808	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34572596	Associate	★☆☆☆☆ Found in Text Mining only