Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79921
Gene name	Transcription elongation factor A like 4
Gene symbol	TCEAL4
Synonyms (NCBI Gene)	NPD017WEX7
Chromosome	X
Chromosome location	Xq22.2
Summary	This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. This family is comprised of nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT609561	hsa-miR-548ac	HITS-CLIP	23824327
MIRT609560	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT609559	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT609558	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT609557	hsa-miR-548z	HITS-CLIP	23824327
MIRT609556	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT609555	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT609554	hsa-miR-1283	HITS-CLIP	23824327
MIRT609561	hsa-miR-548ac	HITS-CLIP	23824327
MIRT609560	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT609559	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT609558	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT609557	hsa-miR-548z	HITS-CLIP	23824327
MIRT609556	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT609555	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT609554	hsa-miR-1283	HITS-CLIP	23824327
MIRT609561	hsa-miR-548ac	HITS-CLIP	23824327
MIRT609560	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT609559	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT609558	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT609557	hsa-miR-548z	HITS-CLIP	23824327
MIRT609556	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT609555	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT609554	hsa-miR-1283	HITS-CLIP	23824327
MIRT609561	hsa-miR-548ac	HITS-CLIP	23824327
MIRT609560	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT609559	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT609558	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT609557	hsa-miR-548z	HITS-CLIP	23824327
MIRT609556	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT609555	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT609554	hsa-miR-1283	HITS-CLIP	23824327
MIRT609561	hsa-miR-548ac	HITS-CLIP	23824327
MIRT609560	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT609559	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT609558	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT609557	hsa-miR-548z	HITS-CLIP	23824327
MIRT609556	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT609555	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT609554	hsa-miR-1283	HITS-CLIP	23824327
MIRT609561	hsa-miR-548ac	HITS-CLIP	23824327
MIRT609560	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT609559	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT609558	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT609557	hsa-miR-548z	HITS-CLIP	23824327
MIRT609556	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT609555	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT609554	hsa-miR-1283	HITS-CLIP	23824327
MIRT1415617	hsa-miR-1245b-3p	CLIP-seq
MIRT1415618	hsa-miR-194	CLIP-seq
MIRT1415619	hsa-miR-3685	CLIP-seq
MIRT1415620	hsa-miR-384	CLIP-seq
MIRT1415621	hsa-miR-4716-5p	CLIP-seq
MIRT1415622	hsa-miR-587	CLIP-seq
MIRT1415617	hsa-miR-1245b-3p	CLIP-seq
MIRT1415623	hsa-miR-141	CLIP-seq
MIRT1415624	hsa-miR-146a	CLIP-seq
MIRT1415625	hsa-miR-146b-5p	CLIP-seq
MIRT1415618	hsa-miR-194	CLIP-seq
MIRT1415626	hsa-miR-200a	CLIP-seq
MIRT1415627	hsa-miR-217	CLIP-seq
MIRT1415628	hsa-miR-33a	CLIP-seq
MIRT1415629	hsa-miR-33b	CLIP-seq
MIRT1415630	hsa-miR-3678-3p	CLIP-seq
MIRT1415619	hsa-miR-3685	CLIP-seq
MIRT1415620	hsa-miR-384	CLIP-seq
MIRT1415631	hsa-miR-4251	CLIP-seq
MIRT1415632	hsa-miR-4459	CLIP-seq
MIRT1415621	hsa-miR-4716-5p	CLIP-seq
MIRT1415633	hsa-miR-4779	CLIP-seq
MIRT1415634	hsa-miR-548a-5p	CLIP-seq
MIRT1415635	hsa-miR-548ab	CLIP-seq
MIRT1415636	hsa-miR-548ak	CLIP-seq
MIRT1415637	hsa-miR-548b-5p	CLIP-seq
MIRT1415638	hsa-miR-548c-5p	CLIP-seq
MIRT1415639	hsa-miR-548d-5p	CLIP-seq
MIRT1415640	hsa-miR-548h	CLIP-seq
MIRT1415641	hsa-miR-548i	CLIP-seq
MIRT1415642	hsa-miR-548j	CLIP-seq
MIRT1415643	hsa-miR-548k	CLIP-seq
MIRT1415644	hsa-miR-548l	CLIP-seq
MIRT1415645	hsa-miR-548w	CLIP-seq
MIRT1415646	hsa-miR-548y	CLIP-seq
MIRT1415647	hsa-miR-556-3p	CLIP-seq
MIRT1415648	hsa-miR-559	CLIP-seq
MIRT1415622	hsa-miR-587	CLIP-seq
MIRT1415649	hsa-miR-589	CLIP-seq
MIRT1415650	hsa-miR-621	CLIP-seq
MIRT1415617	hsa-miR-1245b-3p	CLIP-seq
MIRT1415651	hsa-miR-186	CLIP-seq
MIRT1415652	hsa-miR-3133	CLIP-seq
MIRT1415653	hsa-miR-3613-3p	CLIP-seq
MIRT1415654	hsa-miR-4266	CLIP-seq
MIRT1415655	hsa-miR-4520a-3p	CLIP-seq
MIRT1415656	hsa-miR-4694-3p	CLIP-seq
MIRT1415657	hsa-miR-4744	CLIP-seq
MIRT1415658	hsa-miR-4773	CLIP-seq
MIRT1415659	hsa-miR-548c-3p	CLIP-seq
MIRT1415660	hsa-miR-651	CLIP-seq
MIRT1415617	hsa-miR-1245b-3p	CLIP-seq
MIRT1415618	hsa-miR-194	CLIP-seq
MIRT2124671	hsa-miR-2053	CLIP-seq
MIRT1415619	hsa-miR-3685	CLIP-seq
MIRT1415620	hsa-miR-384	CLIP-seq
MIRT1415631	hsa-miR-4251	CLIP-seq
MIRT2124672	hsa-miR-569	CLIP-seq
MIRT1415632	hsa-miR-4459	CLIP-seq
MIRT1415633	hsa-miR-4779	CLIP-seq
MIRT1415650	hsa-miR-621	CLIP-seq
MIRT2639743	hsa-miR-2276	CLIP-seq
MIRT2639744	hsa-miR-382	CLIP-seq
MIRT2639745	hsa-miR-4772-3p	CLIP-seq
MIRT2639746	hsa-miR-4775	CLIP-seq
MIRT2639747	hsa-miR-590-3p	CLIP-seq

Show/Hide all (2)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IEA

MIM	HGNC	e!Ensembl
301154	26121	ENSG00000133142

Q96EI5

Protein name

Transcription elongation factor A protein-like 4 (TCEA-like protein 4) (Transcription elongation factor S-II protein-like 4)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04538	BEX	66 → 193	Brain expressed X-linked like family	Family

Sequence

MEKLYSENEGMASNQGKMENEEQPQDERKPEVTCTLEDKKLENEGKTENKGKTGDEEMLK
DKGKPESEGEAKEGKSEREGESEMEGGSEREGKPEIEGKPESEGEPGSETRAAGKRPAED
DVPRKAKRKTNKGLAHYLKEYKEAIHDMNFSNEDMIREFDNMAKVQDEKRKSKQKLGAFL
WMQRNLQDPFYPRGPREFRGGCRAPRRDIEDIPYV

Sequence length

215

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SPINOCEREBELLAR ATAXIA TYPE 7	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	17076909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17076909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	17076909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	36368327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	17076909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17076909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17076909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	17076909	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17076909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TCEAL4 (transcription elongation factor A like 4)