Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79893
Gene name	Gametogenetin binding protein 2
Gene symbol	GGNBP2
Synonyms (NCBI Gene)	DIF-3DIF3LCRG1LZK1ZFP403ZNF403
Chromosome	17
Chromosome location	17q12

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments
MIRT1018157	hsa-miR-1273f	CLIP-seq
MIRT1018158	hsa-miR-129-5p	CLIP-seq
MIRT1018159	hsa-miR-135a	CLIP-seq
MIRT1018160	hsa-miR-135b	CLIP-seq
MIRT1018161	hsa-miR-199a-3p	CLIP-seq
MIRT1018162	hsa-miR-199b-3p	CLIP-seq
MIRT1018163	hsa-miR-3064-3p	CLIP-seq
MIRT1018164	hsa-miR-3129-5p	CLIP-seq
MIRT1018165	hsa-miR-323-3p	CLIP-seq
MIRT1018166	hsa-miR-3659	CLIP-seq
MIRT1018167	hsa-miR-3686	CLIP-seq
MIRT1018168	hsa-miR-382	CLIP-seq
MIRT1018169	hsa-miR-4252	CLIP-seq
MIRT1018170	hsa-miR-4311	CLIP-seq
MIRT1018171	hsa-miR-450b-5p	CLIP-seq
MIRT1018172	hsa-miR-4652-3p	CLIP-seq
MIRT1018173	hsa-miR-4658	CLIP-seq
MIRT1018174	hsa-miR-4715-3p	CLIP-seq
MIRT1018175	hsa-miR-4776-3p	CLIP-seq
MIRT1018176	hsa-miR-488	CLIP-seq
MIRT1018177	hsa-miR-507	CLIP-seq
MIRT1018178	hsa-miR-513a-3p	CLIP-seq
MIRT1018179	hsa-miR-524-3p	CLIP-seq
MIRT1018180	hsa-miR-525-3p	CLIP-seq
MIRT1018181	hsa-miR-557	CLIP-seq
MIRT1018182	hsa-miR-574-5p	CLIP-seq
MIRT1018183	hsa-miR-616	CLIP-seq
MIRT1018165	hsa-miR-323-3p	CLIP-seq
MIRT1018175	hsa-miR-4776-3p	CLIP-seq
MIRT2001568	hsa-miR-513a-5p	CLIP-seq
MIRT2234586	hsa-miR-1264	CLIP-seq
MIRT1018158	hsa-miR-129-5p	CLIP-seq
MIRT1018161	hsa-miR-199a-3p	CLIP-seq
MIRT1018162	hsa-miR-199b-3p	CLIP-seq
MIRT2234587	hsa-miR-224	CLIP-seq
MIRT1018163	hsa-miR-3064-3p	CLIP-seq
MIRT1018164	hsa-miR-3129-5p	CLIP-seq
MIRT1018165	hsa-miR-323-3p	CLIP-seq
MIRT2234588	hsa-miR-342-3p	CLIP-seq
MIRT2234589	hsa-miR-3618	CLIP-seq
MIRT1018167	hsa-miR-3686	CLIP-seq
MIRT2234590	hsa-miR-3691-5p	CLIP-seq
MIRT1018168	hsa-miR-382	CLIP-seq
MIRT1018169	hsa-miR-4252	CLIP-seq
MIRT2234591	hsa-miR-4289	CLIP-seq
MIRT1018170	hsa-miR-4311	CLIP-seq
MIRT1018172	hsa-miR-4652-3p	CLIP-seq
MIRT2234592	hsa-miR-4659a-5p	CLIP-seq
MIRT2234593	hsa-miR-4659b-5p	CLIP-seq
MIRT1018174	hsa-miR-4715-3p	CLIP-seq
MIRT2234594	hsa-miR-4764-5p	CLIP-seq
MIRT1018175	hsa-miR-4776-3p	CLIP-seq
MIRT2001568	hsa-miR-513a-5p	CLIP-seq
MIRT1018179	hsa-miR-524-3p	CLIP-seq
MIRT1018180	hsa-miR-525-3p	CLIP-seq
MIRT2234595	hsa-miR-548aa	CLIP-seq
MIRT1018183	hsa-miR-616	CLIP-seq
MIRT2234596	hsa-miR-934	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0060711	Process	Labyrinthine layer development	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:1904893	Process	Negative regulation of receptor signaling pathway via STAT	IEA

MIM	HGNC	e!Ensembl
612275	19357	ENSG00000278311

Q9H3C7

Protein name

Gametogenetin-binding protein 2 (Laryngeal carcinoma-related protein 1) (Protein ZNF403)

Protein function

May be involved in spermatogenesis.

PDB

8BFJ

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed more abundantly in heart, pancreas and skeletal muscle. {ECO:0000269|PubMed:15145523}.

Sequence

MARLVAVCRDGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDGHQNNGAQLKQFIQRH
GMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLVESGNPALEPLTVGPKG
VLSVTRSCMTDAKKLYTLFYVHGSKLNDMIDAIPKSKKNKRCQLHSLDTHKPKPLGGCWM
DVWELMSQECRDEVVLIDSSCLLETLETYLRKHRFCTDCKNKVLRAYNILIGELDCSKEK
GYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGRRERHAKTIDIAQEEVLT
CLGIHLYERLHRIWQKLRAEEQTWQMLFYLGVDALRKSFEMTVEKVQGISRLEQLCEEFS
EEERVRELKQEKKRQKRKNRRKNKCVCDIPTPLQTADEKEVSQEKETDFIENSSCKACGS
TEDGNTCVEVIVTNENTSCTCPSSGNLLGSPKIKKGLSPHCNGSDCGYSSSMEGSETGSR
EGSDVACTEGICNHDEHGDDSCVHHCEDKEDDGDSCVECWANSEENDTKGKNKKKKKKSK
ILKCDEHIQKLGSCITDPGNRETSGNTMHTVFHRDKTKDTHPESCCSSEKGGQPLPWFEH
RKNVPQFAEPTETLFGPDSGKGAKSLVELLDESECTSDEEIFISQDEIQSFMANNQSFYS
NREQYRQHLKEKFNKYCRLNDHKRPICSGWLTTAGAN

Sequence length

697

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEVELOPMENTAL DISABILITIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GGNBP2-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28639078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	28639078, 33541344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30450530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	15145523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24842157, 28864131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	36109160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28244851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28244851	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	25913757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30450530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24842157, 28864131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31797427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24842157, 25913757, 30450530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37300932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15145523, 24842157, 28244851, 28592902, 28864131, 29093342, 30450530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	9852682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37300932	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30450530		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24842157, 28864131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31797427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30450530		★★★★★ ★☆☆☆☆ Found in Text Mining only

GGNBP2 (gametogenetin binding protein 2)