RIN3 (Ras and Rab interactor 3)

Gene

• Entrez ID: 79890
• Gene name: Ras and Rab interactor 3
• Gene symbol: RIN3
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q32.12
• Summary: Summary: This protein encoded by this gene is a member of the RIN family of Ras interaction-interference proteins, which are binding partners to the RAB5 small GTPases. The protein functions as a guanine nucleotide exchange for RAB5B and RAB31. Alternativ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT491628	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491626	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491625	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491624	hsa-miR-5194	PAR-CLIP	23592263
MIRT491623	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491622	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491621	hsa-miR-4710	PAR-CLIP	23592263
MIRT491620	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT491628	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491626	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491625	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491624	hsa-miR-5194	PAR-CLIP	23592263
MIRT491623	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491622	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491621	hsa-miR-4710	PAR-CLIP	23592263
MIRT491620	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT1307300	hsa-miR-2110	CLIP-seq
MIRT1307301	hsa-miR-22	CLIP-seq
MIRT1307302	hsa-miR-28-5p	CLIP-seq
MIRT1307303	hsa-miR-3139	CLIP-seq
MIRT1307304	hsa-miR-3150b-3p	CLIP-seq
MIRT1307305	hsa-miR-3184	CLIP-seq
MIRT1307306	hsa-miR-3197	CLIP-seq
MIRT1307307	hsa-miR-4271	CLIP-seq
MIRT1307308	hsa-miR-4300	CLIP-seq
MIRT1307309	hsa-miR-4488	CLIP-seq
MIRT1307310	hsa-miR-4633-3p	CLIP-seq
MIRT1307311	hsa-miR-4667-5p	CLIP-seq
MIRT1307312	hsa-miR-4689	CLIP-seq
MIRT1307313	hsa-miR-4697-5p	CLIP-seq
MIRT1307314	hsa-miR-4700-5p	CLIP-seq
MIRT1307315	hsa-miR-4706	CLIP-seq
MIRT1307316	hsa-miR-4725-3p	CLIP-seq
MIRT1307317	hsa-miR-4734	CLIP-seq
MIRT1307318	hsa-miR-4749-5p	CLIP-seq
MIRT1307319	hsa-miR-4784	CLIP-seq
MIRT1307320	hsa-miR-544b	CLIP-seq
MIRT1307321	hsa-miR-558	CLIP-seq
MIRT1307322	hsa-miR-610	CLIP-seq
MIRT1307323	hsa-miR-637	CLIP-seq
MIRT1307324	hsa-miR-661	CLIP-seq
MIRT1307325	hsa-miR-708	CLIP-seq
MIRT1307326	hsa-miR-744	CLIP-seq
MIRT1307327	hsa-miR-920	CLIP-seq
MIRT2091089	hsa-miR-2278	CLIP-seq
MIRT2091090	hsa-miR-3155	CLIP-seq
MIRT2091091	hsa-miR-3155b	CLIP-seq
MIRT2091092	hsa-miR-4299	CLIP-seq
MIRT2091093	hsa-miR-4456	CLIP-seq
MIRT2091094	hsa-miR-4690-5p	CLIP-seq
MIRT2091095	hsa-miR-484	CLIP-seq
MIRT2091096	hsa-miR-548q	CLIP-seq
MIRT2091097	hsa-miR-760	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002091	Process	Negative regulation of receptor internalization	IMP	23185384
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	21586568, 23185384
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	17474147, 23185384, 25814554, 32552912, 35271311
GO:0005737	Component	Cytoplasm	IDA	18486601
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21586568
GO:0005769	Component	Early endosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006897	Process	Endocytosis	NAS	11733506
GO:0007165	Process	Signal transduction	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030139	Component	Endocytic vesicle	IBA
GO:0030139	Component	Endocytic vesicle	IDA	18486601
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS	32552912
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS	32552912
GO:0031267	Function	Small GTPase binding	IBA
GO:0031267	Function	Small GTPase binding	IDA	21586568
GO:0031267	Function	Small GTPase binding	TAS	18486601
GO:0031410	Component	Cytoplasmic vesicle	IDA	21586568
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031982	Component	Vesicle	IDA	32552912
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS	32552912
GO:0060755	Process	Negative regulation of mast cell chemotaxis	IMP	23185384
GO:0097494	Process	Regulation of vesicle size	IDA	32552912

Other IDs

• MIM: 610223
• HGNC: 18751
• e!Ensembl: ENSG00000100599

Protein

• UniProt ID: Q8TB24
• Protein name: Ras and Rab interactor 3 (Ras interaction/interference protein 3)
• Protein function: Ras effector protein that functions as a guanine nucleotide exchange (GEF) for RAB5B and RAB31, by exchanging bound GDP for free GTP. Required for normal RAB31 function.
• PDB: 3U23, 4WCI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02204	VPS9	739 → 842	Vacuolar sorting protein 9 (VPS9) domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12972505}.
• Sequence:

  MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTC
  PVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE
  KSILYLEGSALVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFW
  DSSLNPPQERGKPAEPPRDRAPGFPLVSSLRPTAHDANCACEIELSVGNDRLWFVNPIFI
  EDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRPPPPPPVLPLQPCSPAQPPVL
  PALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAGLGPLREEAMK
  PGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD
  GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLEN
  AELCTQAMALETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGV
  SVMATDQDSYSTSSTEEELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRK
  LYKKVVELAQDKGSYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTE
  LKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQLVIL
  ATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIYDSMALGNPGK
  PYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY
  DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADT
  QAQALCAQCAEKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVY
  RPLDGGGGGGGGSPPCLVVREPNFL

• Sequence length: 985

Pathways

Reactome:

RAB GEFs exchange GTP for GDP on RABs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RIN3-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC JUVENILE IDIOPATHIC ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	28199971, 30258121, 30830563, 33419465, 33794991, 35090342, 35241726, 36411364, 37322917	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	28738127		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	33419465	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	17156400	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28199971, 37322917	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37322917	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30830563		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	30830563	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	30830563	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	30830563		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26635082	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	Pubtator	23185384	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28445147		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28445147	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	CTD_human_DG	21623375		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	24945404, 25701875, 30726512		★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	24945404, 25701875		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30830563		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25171373, 37422806	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	30830563	Associate	★☆☆☆☆ Found in Text Mining only