NUDT18 (nudix hydrolase 18)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 79873
Gene name Nudix hydrolase 18
Gene symbol NUDT18
Synonyms (NCBI Gene)
MTH3
Chromosome 8
Chromosome location 8p21.3
Summary The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofacto
miRNA miRNA information provided by mirtarbase database.
91
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (91)
miRTarBase ID miRNA Experiments Reference
MIRT708629 hsa-miR-6819-3p HITS-CLIP 19536157
MIRT708628 hsa-miR-6877-3p HITS-CLIP 19536157
MIRT708627 hsa-miR-6847-5p HITS-CLIP 19536157
MIRT708626 hsa-miR-4257 HITS-CLIP 19536157
MIRT708625 hsa-miR-6849-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19060904, 21044950, 22458338, 31515488
GO:0005829 Component Cytosol TAS
GO:0009117 Process Nucleotide metabolic process IEA
GO:0016787 Function Hydrolase activity IEA
GO:0017110 Function Nucleoside diphosphate phosphatase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
615791 26194 ENSG00000275074
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZVK8
Protein name 8-oxo-dGDP phosphatase NUDT18 (EC 3.6.1.58) (2-hydroxy-dADP phosphatase) (7,8-dihydro-8-oxoguanine phosphatase) (MutT homolog 3) (Nucleoside diphosphate-linked moiety X motif 18) (Nudix motif 18)
Protein function Mediates the hydrolysis of oxidized nucleoside diphosphate derivatives. Hydrolyzes 8-oxo-7,8-dihydroguanine (8-oxo-Gua)-containing deoxyribo- and ribonucleoside diphosphates to the monophosphates. Hydrolyzes 8-oxo-dGDP and 8-oxo-GDP with the sam
PDB 3GG6 , 4HVY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00293 NUDIX 43 → 163 NUDIX domain Domain
Sequence 
MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLI
QEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVF
LARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILP
QELPCDLVCQRLVATFTSAQTVWVLVGTVGMPHLPVTACGLDPMEQRGGMKMAVLRLLQE
CLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKV
MEEDLQSQLLQRLQGSSVVPVNR
Sequence length 323
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Phosphate bond hydrolysis by NUDT proteins
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CUTANEOUS MELANOMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast adenocarcinoma Breast Adenocarcinoma BEFREE 29138806
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 29138806 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only
Triple Negative Breast Neoplasms Triple Negative Breast Neoplasms BEFREE 29138806
★★★★★
★☆☆☆☆
Found in Text Mining only
Triple Negative Breast Neoplasms Triple negative breast cancer Pubtator 29138806 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Triple Negative Breast Neoplasms Triple negative breast cancer Pubtator 34013378 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only