Gene Gene information from NCBI Gene database.
Entrez ID 79868
Gene name ALG13 UDP-N-acetylglucosaminyltransferase subunit
Gene symbol ALG13
Synonyms (NCBI Gene)
CDG1SCXorf45DEE36EIEE36GLT28D1MDS031TDRD13YGL047W
Chromosome X
Chromosome location Xq23
Summary The protein encoded by this gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizes with asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes the second sugar additi
SNPs SNP information provided by dbSNP.
9
SNP ID Visualize variation Clinical significance Consequence
rs138712375 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant, genic downstream transcript variant
rs145518377 A>G Conflicting-interpretations-of-pathogenicity 5 prime UTR variant, missense variant, genic upstream transcript variant, coding sequence variant, non coding transcript variant, synonymous variant
rs189931917 A>C,G Conflicting-interpretations-of-pathogenicity Non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant
rs398122394 A>G Pathogenic Missense variant, 5 prime UTR variant, synonymous variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
rs746842727 G>A Likely-benign, conflicting-interpretations-of-pathogenicity Non coding transcript variant, synonymous variant, coding sequence variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
146
miRTarBase ID miRNA Experiments Reference
MIRT051473 hsa-let-7e-5p CLASH 23622248
MIRT445792 hsa-miR-548m PAR-CLIP 22100165
MIRT445791 hsa-miR-1183 PAR-CLIP 22100165
MIRT445790 hsa-miR-3607-3p PAR-CLIP 22100165
MIRT445789 hsa-miR-4786-5p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0004577 Function N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity IDA 36200043
GO:0004577 Function N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity IDA 36200043
GO:0004577 Function N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity IEA
GO:0004577 Function N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase activity IMP 22492991
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300776 30881 ENSG00000101901
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NP73
Protein name UDP-N-acetylglucosamine transferase subunit ALG13 (EC 2.4.1.141) (Asparagine-linked glycosylation 13 homolog) (Glycosyltransferase 28 domain-containing protein 1)
Protein function Catalytic subunit of the UDP-N-acetylglucosamine transferase complex that operates in the biosynthetic pathway of dolichol-linked oligosaccharides, the glycan precursors employed in protein asparagine (N)-glycosylation. The assembly of dolichol-
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04101 Glyco_tran_28_C 3 133 Glycosyltransferase family 28 C-terminal domain Domain
PF02338 OTU 237 348 OTU-like cysteine protease Family
Sequence
MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDV
YRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEG
HLFYCTCRVLTCP
GQAKSIASAPGKCQDSAALTSTAFSGLDFGLLSGYLHKQALVTATHP
TCTLLFPSCHAFFPLPLTPTLYKMHKGWKNYCSQKSLNEASMDEYLGSLGLFRKLTAKDA
SCLFRAISEQLFCSQVHHLEIRKACVSYMRENQQTFESYVEGSFEKYLERLGDPKESAGQ
LEIRALSLIYNRDFILYRFPGKPPTYVTDNGYEDKILLCYSSSGHYDS
VYSKQFQSSAAV
CQAVLYEILYKDVFVVDEEELKTAIKLFRSGSKKNRNNAVTGSEDAHTDYKSSNQNRMEE
WGACYNAENIPEGYNKGTEETKSPENPSKMPFPYKVLKALDPEIYRNVEFDVWLDSRKEL
QKSDYMEYAGRQYYLGDKCQVCLESEGRYYNAHIQEVGNENNSVTVFIEELAEKHVVPLA
NLKPVTQVMSVPAWNAMPSRKGRGYQKMPGGYVPEIVISEMDIKQQKKMFKKIRGKEVYM
TMAYGKGDPLLPPRLQHSMHYGHDPPMHYSQTAGNVMSNEHFHPQHPSPRQGRGYGMPRN
SSRFINRHNMPGPKVDFYPGPGKRCCQSYDNFSYRSRSFRRSHRQMSCVNKESQYGFTPG
NGQMPRGLEETITFYEVEEGDETAYPTLPNHGGPSTMVPATSGYCVGRRGHSSGKQTLNL
EEGNGQSENGRYHEEYLYRAEPDYETSGVYSTTASTANLSLQDRKSCSMSPQDTVTSYNY
PQKMMGNIAAVAASCANNVPAPVLSNGAAANQAISTTSVSSQNAIQPLFVSPPTHGRPVI
ASPSYPCHSAIPHAGASLPPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPP
LPPPPYSCDPSGSDLPQDTKVLQYYFNLGLQCYYHSYWHSMVYVPQMQQQLHVENYPVYT
EPPLVDQTVPQCYSEVRREDGIQAEASANDTFPNADSSSVPHGAVYYPVMSDPYGQPPLP
GFDSCLPVVPDYSCVPPWHPVGTAYGGSSQIHGAINPGPIGCIAPSPPASHYVPQGM
Sequence length 1137
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  N-Glycan biosynthesis
Various types of N-glycan biosynthesis
Metabolic pathways
  Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Defective ALG14 causes congenital myasthenic syndrome (ALG14-CMS)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
53
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
ALG13-related disorder Likely pathogenic; Pathogenic rs398122394 RCV003925015
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital disorder of glycosylation Likely pathogenic rs2147626590, rs1569508922 RCV001543374
RCV001543373
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Developmental and epileptic encephalopathy, 36 Likely pathogenic; Pathogenic rs1945385727, rs2147624939, rs2525054281, rs867599353, rs398122394 RCV002221292
RCV002249246
RCV003444180
RCV000032994
RCV000056321
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypotonia Likely pathogenic; Pathogenic rs398122394 RCV001849307
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Uncertain significance; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
2-3 toe syndactyly Syndactyly Of The Toes HPO_DG
★☆☆☆☆
Found in Text Mining only
ALG13-CDG Congenital Disorder Of Glycosylation Orphanet
★☆☆☆☆
Found in Text Mining only
Attention deficit hyperactivity disorder Attention Deficit Hyperactivity Disorder HPO_DG
★☆☆☆☆
Found in Text Mining only
Autistic behavior Autism HPO_DG
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism HPO_DG
★☆☆☆☆
Found in Text Mining only
Awakening Epilepsy Epilepsy CTD_human_DG 29942082
★☆☆☆☆
Found in Text Mining only
Azoospermia Nonobstructive Nonobstructive azoospermia Pubtator 36017582 Associate
★☆☆☆☆
Found in Text Mining only
Brachycephaly Brachycephaly CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Brain atrophy Brain atrophy CLINVAR_DG 23934111
★☆☆☆☆
Found in Text Mining only
Brain Diseases Brain disease Pubtator 23934111, 27476654, 29190809, 33734437, 37469072, 39311797 Associate
★☆☆☆☆
Found in Text Mining only