Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79865
Gene name	Triggering receptor expressed on myeloid cells like 2
Gene symbol	TREML2
Synonyms (NCBI Gene)	C6orf76TLT-2TLT2dJ238O23.1
Chromosome	6
Chromosome location	6p21.1
Summary	TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]).

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT606906	hsa-miR-6783-5p	HITS-CLIP	23313552
MIRT606905	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT606904	hsa-miR-6824-5p	HITS-CLIP	23313552
MIRT606903	hsa-miR-135b-3p	HITS-CLIP	23313552
MIRT606902	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT606906	hsa-miR-6783-5p	HITS-CLIP	24906430
MIRT606905	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT606904	hsa-miR-6824-5p	HITS-CLIP	24906430
MIRT606903	hsa-miR-135b-3p	HITS-CLIP	24906430
MIRT606902	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT606906	hsa-miR-6783-5p	HITS-CLIP	24906430
MIRT606905	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT606904	hsa-miR-6824-5p	HITS-CLIP	24906430
MIRT606903	hsa-miR-135b-3p	HITS-CLIP	24906430
MIRT606902	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT606902	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT606905	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT739232	hsa-miR-3120-5p	HITS-CLIP	33718276
MIRT606906	hsa-miR-6783-5p	HITS-CLIP	23313552
MIRT606905	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT606904	hsa-miR-6824-5p	HITS-CLIP	23313552
MIRT606903	hsa-miR-135b-3p	HITS-CLIP	23313552
MIRT606902	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT1452417	hsa-miR-1285	CLIP-seq
MIRT1452418	hsa-miR-1827	CLIP-seq
MIRT1452419	hsa-miR-1915	CLIP-seq
MIRT1452420	hsa-miR-199a-5p	CLIP-seq
MIRT1452421	hsa-miR-199b-5p	CLIP-seq
MIRT1452422	hsa-miR-2355-5p	CLIP-seq
MIRT1452423	hsa-miR-296-5p	CLIP-seq
MIRT1452424	hsa-miR-3121-5p	CLIP-seq
MIRT1452425	hsa-miR-3187-5p	CLIP-seq
MIRT1452426	hsa-miR-3194-3p	CLIP-seq
MIRT1452427	hsa-miR-326	CLIP-seq
MIRT1452428	hsa-miR-330-5p	CLIP-seq
MIRT1452429	hsa-miR-378g	CLIP-seq
MIRT1452430	hsa-miR-4286	CLIP-seq
MIRT1452431	hsa-miR-4486	CLIP-seq
MIRT1452432	hsa-miR-4711-5p	CLIP-seq
MIRT1452433	hsa-miR-4749-3p	CLIP-seq
MIRT1452434	hsa-miR-612	CLIP-seq
MIRT2135467	hsa-miR-1343	CLIP-seq
MIRT2135468	hsa-miR-3164	CLIP-seq
MIRT2135469	hsa-miR-3612	CLIP-seq
MIRT2135470	hsa-miR-3690	CLIP-seq
MIRT2135471	hsa-miR-377	CLIP-seq
MIRT2135472	hsa-miR-4254	CLIP-seq
MIRT2135473	hsa-miR-4443	CLIP-seq
MIRT2135474	hsa-miR-4687-3p	CLIP-seq
MIRT2135475	hsa-miR-4695-5p	CLIP-seq
MIRT2135476	hsa-miR-485-5p	CLIP-seq
MIRT2135477	hsa-miR-617	CLIP-seq
MIRT2135478	hsa-miR-650	CLIP-seq
MIRT2135479	hsa-miR-670	CLIP-seq
MIRT2135480	hsa-miR-766	CLIP-seq
MIRT2135467	hsa-miR-1343	CLIP-seq
MIRT1452418	hsa-miR-1827	CLIP-seq
MIRT2356592	hsa-miR-1910	CLIP-seq
MIRT2356593	hsa-miR-198	CLIP-seq
MIRT2356594	hsa-miR-2117	CLIP-seq
MIRT2356595	hsa-miR-214	CLIP-seq
MIRT2356596	hsa-miR-30a	CLIP-seq
MIRT2356597	hsa-miR-30b	CLIP-seq
MIRT2356598	hsa-miR-30c	CLIP-seq
MIRT2356599	hsa-miR-30d	CLIP-seq
MIRT2356600	hsa-miR-30e	CLIP-seq
MIRT2356601	hsa-miR-3183	CLIP-seq
MIRT2356602	hsa-miR-3607-3p	CLIP-seq
MIRT2135469	hsa-miR-3612	CLIP-seq
MIRT2356603	hsa-miR-3619-5p	CLIP-seq
MIRT2356604	hsa-miR-3686	CLIP-seq
MIRT2356605	hsa-miR-3925-3p	CLIP-seq
MIRT2356606	hsa-miR-4268	CLIP-seq
MIRT2356607	hsa-miR-4279	CLIP-seq
MIRT2356608	hsa-miR-4459	CLIP-seq
MIRT2356609	hsa-miR-4530	CLIP-seq
MIRT2356610	hsa-miR-4639-3p	CLIP-seq
MIRT2356611	hsa-miR-4645-5p	CLIP-seq
MIRT2356612	hsa-miR-4659a-3p	CLIP-seq
MIRT2356613	hsa-miR-4659b-3p	CLIP-seq
MIRT2356614	hsa-miR-4673	CLIP-seq
MIRT2356615	hsa-miR-4691-5p	CLIP-seq
MIRT2135475	hsa-miR-4695-5p	CLIP-seq
MIRT2356616	hsa-miR-4722-5p	CLIP-seq
MIRT2356617	hsa-miR-4723-3p	CLIP-seq
MIRT2356618	hsa-miR-483-3p	CLIP-seq
MIRT2135476	hsa-miR-485-5p	CLIP-seq
MIRT2356619	hsa-miR-515-5p	CLIP-seq
MIRT2356620	hsa-miR-520a-5p	CLIP-seq
MIRT2356621	hsa-miR-525-5p	CLIP-seq
MIRT2135478	hsa-miR-650	CLIP-seq
MIRT2356622	hsa-miR-761	CLIP-seq
MIRT2135480	hsa-miR-766	CLIP-seq
MIRT2396330	hsa-miR-335	CLIP-seq
MIRT2396331	hsa-miR-622	CLIP-seq
MIRT2441508	hsa-miR-1184	CLIP-seq
MIRT2441509	hsa-miR-2467-5p	CLIP-seq
MIRT2441510	hsa-miR-4690-3p	CLIP-seq
MIRT2441508	hsa-miR-1184	CLIP-seq
MIRT2441509	hsa-miR-2467-5p	CLIP-seq
MIRT2441510	hsa-miR-4690-3p	CLIP-seq
MIRT2462300	hsa-miR-3192	CLIP-seq
MIRT1452427	hsa-miR-326	CLIP-seq
MIRT1452428	hsa-miR-330-5p	CLIP-seq
MIRT1452430	hsa-miR-4286	CLIP-seq
MIRT2462301	hsa-miR-4314	CLIP-seq
MIRT2462302	hsa-miR-4434	CLIP-seq
MIRT2462303	hsa-miR-4516	CLIP-seq
MIRT2462304	hsa-miR-4646-5p	CLIP-seq
MIRT2462300	hsa-miR-3192	CLIP-seq
MIRT1452427	hsa-miR-326	CLIP-seq
MIRT1452428	hsa-miR-330-5p	CLIP-seq
MIRT1452430	hsa-miR-4286	CLIP-seq
MIRT2462301	hsa-miR-4314	CLIP-seq
MIRT2462302	hsa-miR-4434	CLIP-seq
MIRT2462303	hsa-miR-4516	CLIP-seq
MIRT2462304	hsa-miR-4646-5p	CLIP-seq
MIRT2441508	hsa-miR-1184	CLIP-seq
MIRT2441509	hsa-miR-2467-5p	CLIP-seq
MIRT2441510	hsa-miR-4690-3p	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18650384
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	18650384
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IDA	18650384
GO:0042110	Process	T cell activation	IBA
GO:0042110	Process	T cell activation	IDA	18650384

MIM	HGNC	e!Ensembl
609715	21092	ENSG00000112195

Q5T2D2

Protein name

Trem-like transcript 2 protein (TLT-2) (Triggering receptor expressed on myeloid cells-like protein 2)

Protein function

Cell surface receptor that may play a role in the innate and adaptive immune response. Acts as a counter-receptor for CD276 and interaction with CD276 on T-cells enhances T-cell activation. {ECO:0000269|PubMed:12645956, ECO:0000269|PubMed:186503

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected in cultured B-cells, T-cell leukemia and monocyte leukemia. Expressed constitutively on CD8 T-cells and induced on CD4 T-cells after activation. {ECO:0000269|PubMed:12645956, ECO:0000269|PubMed:18650384}.

Sequence

MAPAFLLLLLLWPQGCVSGPSADSVYTKVRLLEGETLSVQCSYKGYKNRVEGKVWCKIRK
KKCEPGFARVWVKGPRYLLQDDAQAKVVNITMVALKLQDSGRYWCMRNTSGILYPLMGFQ
LDVSPAPQTERNIPFTHLDNILKSGTVTTGQAPTSGPDAPFTTGVMVFTPGLITLPRLLA
STRPASKTGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLSTRSP
TTGLCLTSRSLLNRLPSMPSIRHQDVYSTVLGVVLTLLVLMLIMVYGFWKKRHMASYSMC
SDPSTRDPPGRPEPYVEVYLI

Sequence length

321

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	24439484, 25545807, 26243271, 32073739, 36430248	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	26797517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40033250	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29778423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	31044564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24142389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36430248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36978087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39972314	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracic Diseases	Thoracic disease	Pubtator	36796491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TREML2 (triggering receptor expressed on myeloid cells like 2)