Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79861
Gene name	Tubulin alpha like 3
Gene symbol	TUBAL3
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10p15.1

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019280	hsa-miR-148b-3p	Microarray	17612493
MIRT021591	hsa-miR-142-3p	Microarray	17612493
MIRT495668	hsa-miR-6783-5p	PAR-CLIP	22291592
MIRT495667	hsa-miR-4301	PAR-CLIP	22291592
MIRT495666	hsa-miR-4471	PAR-CLIP	22291592
MIRT495665	hsa-miR-8059	PAR-CLIP	22291592
MIRT495668	hsa-miR-6783-5p	PAR-CLIP	22291592
MIRT495667	hsa-miR-4301	PAR-CLIP	22291592
MIRT495666	hsa-miR-4471	PAR-CLIP	22291592
MIRT495665	hsa-miR-8059	PAR-CLIP	22291592
MIRT1463017	hsa-miR-570	CLIP-seq
MIRT2139291	hsa-miR-181a	CLIP-seq
MIRT2139292	hsa-miR-181b	CLIP-seq
MIRT2139293	hsa-miR-181c	CLIP-seq
MIRT2139294	hsa-miR-181d	CLIP-seq
MIRT2139295	hsa-miR-4262	CLIP-seq
MIRT2139296	hsa-miR-489	CLIP-seq
MIRT2139297	hsa-miR-579	CLIP-seq
MIRT2139298	hsa-miR-664	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0005200	Function	Structural constituent of cytoskeleton	IBA
GO:0005200	Function	Structural constituent of cytoskeleton	IEA
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
620835	23534	ENSG00000178462

A6NHL2

Protein name

Tubulin alpha chain-like 3 (EC 3.6.5.-)

Protein function

Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule en

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00091	Tubulin	3 → 221	Tubulin/FtsZ family, GTPase domain	Domain
PF03953	Tubulin_C	270 → 400	Tubulin C-terminal domain	Domain

Sequence

MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKMEHTNASFDTFF
CETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSE
VIDLVLERTRKLAEQCGGLQGFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYP
APRISTAVVEPYNSVLTTHSTTEHTDCTFMVDNEAVYDICHRKLGVECPSHASINRLVVQ
VVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITT
ACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKV
GINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLREGM
EEAEFLEAREDLAALERDYEEVAQSF

Sequence length

446

Interactions

View interactions

	KEGG		Reactome
	Phagosome Apoptosis Tight junction Gap junction Motor proteins Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Pathogenic Escherichia coli infection Salmonella infection		Microtubule-dependent trafficking of connexons from Golgi to the plasma membrane MHC class II antigen presentation Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion HSP90 chaperone cycle for steroid hormone receptors (SHR) Recruitment of NuMA to mitotic centrosomes Recycling pathway of L1 Cilium Assembly RHO GTPases activate IQGAPs RHO GTPases Activate Formins COPI-mediated anterograde transport COPI-dependent Golgi-to-ER retrograde traffic COPI-independent Golgi-to-ER retrograde traffic Mitotic Prometaphase The role of GTSE1 in G2/M progression after G2 checkpoint Carboxyterminal post-translational modifications of tubulin HCMV Early Events Aggrephagy EML4 and NUDC in mitotic spindle formation Sealing of the nuclear envelope (NE) by ESCRT-III Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TUBAL3 (tubulin alpha like 3)