Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79844
Gene name	ZDHHC palmitoyltransferase 11
Gene symbol	ZDHHC11
Synonyms (NCBI Gene)	ZNF399
Chromosome	5
Chromosome location	5p15.33

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018606	hsa-miR-335-5p	Microarray	18185580
MIRT019928	hsa-miR-375	Microarray	20215506
MIRT1507678	hsa-miR-1183	CLIP-seq
MIRT1507679	hsa-miR-1184	CLIP-seq
MIRT1507680	hsa-miR-1205	CLIP-seq
MIRT1507681	hsa-miR-1278	CLIP-seq
MIRT1507682	hsa-miR-3158-5p	CLIP-seq
MIRT1507683	hsa-miR-3934	CLIP-seq
MIRT1507684	hsa-miR-4264	CLIP-seq
MIRT1507685	hsa-miR-4690-3p	CLIP-seq
MIRT1507686	hsa-miR-4797-3p	CLIP-seq
MIRT1507687	hsa-miR-513a-5p	CLIP-seq
MIRT1507688	hsa-miR-552	CLIP-seq
MIRT1507689	hsa-miR-885-3p	CLIP-seq
MIRT1507678	hsa-miR-1183	CLIP-seq
MIRT2152896	hsa-miR-1262	CLIP-seq
MIRT2152897	hsa-miR-1272	CLIP-seq
MIRT1507681	hsa-miR-1278	CLIP-seq
MIRT2152898	hsa-miR-142-3p	CLIP-seq
MIRT2152899	hsa-miR-199a-3p	CLIP-seq
MIRT2152900	hsa-miR-199b-3p	CLIP-seq
MIRT2152901	hsa-miR-3129-5p	CLIP-seq
MIRT1507684	hsa-miR-4264	CLIP-seq
MIRT2152902	hsa-miR-4280	CLIP-seq
MIRT2152903	hsa-miR-4318	CLIP-seq
MIRT2152904	hsa-miR-4455	CLIP-seq
MIRT2152905	hsa-miR-4693-5p	CLIP-seq
MIRT2152906	hsa-miR-4699-5p	CLIP-seq
MIRT2152907	hsa-miR-4701-3p	CLIP-seq
MIRT1507686	hsa-miR-4797-3p	CLIP-seq
MIRT2152908	hsa-miR-609	CLIP-seq
MIRT2152909	hsa-miR-892a	CLIP-seq
MIRT2152910	hsa-miR-936	CLIP-seq
MIRT1507678	hsa-miR-1183	CLIP-seq
MIRT2152896	hsa-miR-1262	CLIP-seq
MIRT2152897	hsa-miR-1272	CLIP-seq
MIRT1507681	hsa-miR-1278	CLIP-seq
MIRT2152898	hsa-miR-142-3p	CLIP-seq
MIRT2152899	hsa-miR-199a-3p	CLIP-seq
MIRT2152900	hsa-miR-199b-3p	CLIP-seq
MIRT2152901	hsa-miR-3129-5p	CLIP-seq
MIRT2373234	hsa-miR-3652	CLIP-seq
MIRT1507684	hsa-miR-4264	CLIP-seq
MIRT2152902	hsa-miR-4280	CLIP-seq
MIRT2152903	hsa-miR-4318	CLIP-seq
MIRT2373235	hsa-miR-4430	CLIP-seq
MIRT2152904	hsa-miR-4455	CLIP-seq
MIRT2373236	hsa-miR-4503	CLIP-seq
MIRT2373237	hsa-miR-4520a-3p	CLIP-seq
MIRT2373238	hsa-miR-4638-3p	CLIP-seq
MIRT2152905	hsa-miR-4693-5p	CLIP-seq
MIRT2152906	hsa-miR-4699-5p	CLIP-seq
MIRT2152907	hsa-miR-4701-3p	CLIP-seq
MIRT1507686	hsa-miR-4797-3p	CLIP-seq
MIRT2152908	hsa-miR-609	CLIP-seq
MIRT2152909	hsa-miR-892a	CLIP-seq
MIRT2152910	hsa-miR-936	CLIP-seq
MIRT1507681	hsa-miR-1278	CLIP-seq
MIRT2152903	hsa-miR-4318	CLIP-seq
MIRT2152905	hsa-miR-4693-5p	CLIP-seq
MIRT2152909	hsa-miR-892a	CLIP-seq
MIRT2695620	hsa-miR-3605-5p	CLIP-seq
MIRT2695621	hsa-miR-4797-5p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	29429998
GO:0005515	Function	Protein binding	IPI	29429998, 32296183
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	16647879
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0010008	Component	Endosome membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0018230	Process	Peptidyl-L-cysteine S-palmitoylation	ISS
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IBA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	ISS
GO:0035591	Function	Signaling adaptor activity	IDA	29429998
GO:0140374	Process	Antiviral innate immune response	IBA
GO:0140374	Process	Antiviral innate immune response	IMP	29429998

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9H8X9

Protein name

Palmitoyltransferase ZDHHC11 (EC 2.3.1.225) (Zinc finger DHHC domain-containing protein 11) (DHHC-11) (Zinc finger protein 399)

Protein function

Endoplasmic reticulum-localized palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates and be involved in a variety of cellular processes (By similarity). Has a palmitoyltransferase activity toward NCD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01529	DHHC	120 → 275	DHHC palmitoyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:16647879}.

Sequence

MDTRSGSQCSVTPEAILNNEKLVLPPRISRVNGWSLPLHYFQVVTWAVFVGLSSATFGIF
IPFLPHAWKYIAYVVTGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAH
VIQNQFCHLCKVTVNKKTKHCISCNKCVSGFDHHCKWINNCVGSRNYWFFFSTVASATAG
MLCLIAILLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFPVQVQTLIVVIIGMLV
LLLDFLGLVHLGQLLIFHIYLKAKKMTTFEYLINNRKEESSKHQAVRKDPYVQMDKGVLQ
QGAGALGSSAQGVKAKSSLLIHKHLCHFCTSVNQDGDSTAREGDEDPCPSALGAKARNSR
LICRRLCQFSTRVHPDGGSMAQEADDAPSISTLGLQQETTEPMKTDSAESED

Sequence length

412

Interactions

View interactions

	KEGG
	Cytosolic DNA-sensing pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18025801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18025801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	35205272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18025801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	34348663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	35205272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18025801		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZDHHC11 (zDHHC palmitoyltransferase 11)