ARHGEF5 (Rho guanine nucleotide exchange factor 5)

Gene

• Entrez ID: 7984
• Gene name: Rho guanine nucleotide exchange factor 5
• Gene symbol: ARHGEF5
• Synonyms (NCBI Gene): GEF5, P60, TIM, TIM1
• Chromosome: 7
• Chromosome location: 7q35
• Summary: Rho GTPases play a fundamental role in numerous cellular processes initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. This protein m

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030322	hsa-miR-26b-5p	Microarray	19088304
MIRT052259	hsa-let-7b-5p	CLASH	23622248
MIRT047144	hsa-miR-183-5p	CLASH	23622248
MIRT630133	hsa-miR-5693	HITS-CLIP	23824327
MIRT630132	hsa-miR-1267	HITS-CLIP	23824327
MIRT630131	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT630130	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT630129	hsa-miR-3135b	HITS-CLIP	23824327
MIRT630128	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT630127	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT630126	hsa-miR-3652	HITS-CLIP	23824327
MIRT630125	hsa-miR-4430	HITS-CLIP	23824327
MIRT630124	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT630123	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT630122	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT630121	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT630120	hsa-miR-8057	HITS-CLIP	23824327
MIRT630119	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT630118	hsa-miR-5698	HITS-CLIP	23824327
MIRT630133	hsa-miR-5693	HITS-CLIP	23824327
MIRT630132	hsa-miR-1267	HITS-CLIP	23824327
MIRT630131	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT630130	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT630129	hsa-miR-3135b	HITS-CLIP	23824327
MIRT630128	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT630127	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT630126	hsa-miR-3652	HITS-CLIP	23824327
MIRT630125	hsa-miR-4430	HITS-CLIP	23824327
MIRT630124	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT630123	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT630122	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT630121	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT630120	hsa-miR-8057	HITS-CLIP	23824327
MIRT630119	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT630118	hsa-miR-5698	HITS-CLIP	23824327
MIRT795979	hsa-miR-3200-3p	CLIP-seq
MIRT795980	hsa-miR-330-3p	CLIP-seq
MIRT795981	hsa-miR-3919	CLIP-seq
MIRT795982	hsa-miR-4330	CLIP-seq
MIRT795983	hsa-miR-4756-3p	CLIP-seq
MIRT795984	hsa-miR-603	CLIP-seq
MIRT1935096	hsa-miR-1470	CLIP-seq
MIRT1935097	hsa-miR-4287	CLIP-seq
MIRT1935098	hsa-miR-4469	CLIP-seq
MIRT1935099	hsa-miR-4667-3p	CLIP-seq
MIRT1935100	hsa-miR-4685-3p	CLIP-seq
MIRT1935101	hsa-miR-4768-3p	CLIP-seq
MIRT1935102	hsa-miR-665	CLIP-seq
MIRT2175032	hsa-miR-23a	CLIP-seq
MIRT2175033	hsa-miR-23b	CLIP-seq
MIRT2175034	hsa-miR-23c	CLIP-seq
MIRT2175035	hsa-miR-3064-3p	CLIP-seq
MIRT795979	hsa-miR-3200-3p	CLIP-seq
MIRT2175036	hsa-miR-3620	CLIP-seq
MIRT2175037	hsa-miR-376c	CLIP-seq
MIRT795981	hsa-miR-3919	CLIP-seq
MIRT2175038	hsa-miR-4317	CLIP-seq
MIRT795982	hsa-miR-4330	CLIP-seq
MIRT2175039	hsa-miR-4502	CLIP-seq
MIRT2175040	hsa-miR-4656	CLIP-seq
MIRT2175041	hsa-miR-4695-3p	CLIP-seq
MIRT2175042	hsa-miR-4715-3p	CLIP-seq
MIRT2175043	hsa-miR-4725-5p	CLIP-seq
MIRT795983	hsa-miR-4756-3p	CLIP-seq
MIRT2175044	hsa-miR-504	CLIP-seq
MIRT795984	hsa-miR-603	CLIP-seq
MIRT2175045	hsa-miR-767-5p	CLIP-seq
MIRT2175046	hsa-miR-877	CLIP-seq
MIRT2175047	hsa-miR-944	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002102	Component	Podosome	IEA
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	15601624
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	12006984, 15778465, 21988832, 24189400, 25416956, 25911094, 27107012, 31980649, 32203420, 32296183, 33961781, 34591642, 36931259
GO:0005525	Function	GTP binding	TAS	8134109
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	14662653
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14662653
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0008289	Function	Lipid binding	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	14662653
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043087	Process	Regulation of GTPase activity	IDA	21525037
GO:0043507	Process	Positive regulation of JUN kinase activity	IDA	15601624
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	15601624
GO:0051493	Process	Regulation of cytoskeleton organization	IMP	15601624
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	15601624
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IDA	15601624
GO:0071803	Process	Positive regulation of podosome assembly	IEA
GO:0071944	Component	Cell periphery	IDA	25911094
GO:1904591	Process	Positive regulation of protein import	IMP	15601624

Other IDs

• MIM: 600888
• HGNC: 13209
• e!Ensembl: ENSG00000050327

Protein

• UniProt ID: Q12774
• Protein name: Rho guanine nucleotide exchange factor 5 (Ephexin-3) (Guanine nucleotide regulatory protein TIM) (Oncogene TIM) (Transforming immortalized mammary oncogene) (p60 TIM)
• Protein function: Guanine nucleotide exchange factor which activates Rho GTPases (PubMed:15601624). Strongly activates RHOA (PubMed:15601624). Also strongly activates RHOB, weakly activates RHOC and RHOG and shows no effect on RHOD, RHOV, RHOQ or RAC1 (By similar
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15441	ARHGEF5_35	1 → 478	RhoGEF 5/35 N-terminal disordered region	Disordered
  PF00621	RhoGEF	1178 → 1356	RhoGEF domain	Domain
  PF14604	SH3_9	1518 → 1567	Variant SH3 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with highest levels in placenta. High levels are also found in colon, kidney, trachea, prostate, liver, pancreas, pituitary gland, thyroid gland and mammary gland. In fetal tissues, expressed at high levels in ki
• Sequence:

  MEAEEAQRGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQ
  QSELRDVCDYAIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLA
  PPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQT
  RYYSPCEEHPAETNQNEGSESGTIRQGEELPPEELQESQGLLHPQEVQVLEEQGQQEAGF
  RGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGL
  NDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQTFLGKSEEVTGKQE
  DHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCD
  LFPGASYLMTQIPGTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFLTEESPDKEID
  QNSQQEESRLRKGTVSSQGTEVVFASASVTPPRTPDSAPPSPAEAYPITPASVSARPPVA
  FPRRETSCAARAPETASAPLSMDDPSPCGTSEMCPAALYGFPSTGTSPPRPPANSTGTVQ
  HLRSDSFPGSHRTEQTPDLVGMLLSYSHSELPQRPPKPAIYSSVTPRRDRRSGRDYSTVS
  ASPTALSTLKQDSQESISNLERPSSPPSIQPWVSPHNPAFATESPAYGSSPSFVSMEDVR
  IHEPLPPPPPQRRDTHPSVVETDGHARVVVPTLKQHSHPPPLALGSGLHAPHKGPLPQAS
  DPAVARQHRPLPSTPDSSHHAQATPRWRYNKPLPPTPDLPQPHLPPISAPGSSRIYRPLP
  PLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPACQDWTVPLPASAGRTSWPP
  ATARSTESFTSTSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGPTSKDEAGVSEHP
  EAPAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSG
  QAVAPSEGANKHKGWSRQGLRRPSILPEGSSDSRGPAVEKHPGPSDTVVFREKKPKEVMG
  GFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPRQPRKALVSSESY
  LQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHF
  QLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAPDF
  RRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRL
  KLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFECK
  IFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVF
  DHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMP
  REELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGW
  FPVQQVEFISNPEVRAQNLKEAHRVKTAKLQLVEQQA

• Sequence length: 1597

Pathways

Reactome:

NRAGE signals death through JNK
Rho GTPase cycle
G alpha (12/13) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	24126923		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25777963		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20232767, 23406933, 23800473		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29936416		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16481347		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11725301, 14630400, 14637143, 15153541, 15683615, 15867855, 16938542, 17117951, 17277130, 17570927, 18727494, 19476019, 19494522, 20415862, 20727045, 21339644, 21470319, 22857392, 23406933, 25152377, 25331534, 26041148, 28434117		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20415862	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	22324461		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29936416		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27609943		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29698674, 30590210		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15565336, 16938542, 18727494, 22857392, 23406933, 24412470, 27091308, 28103916, 31044630		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31644615		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24636202		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25546329		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14662653, 28464854, 29103029, 29552132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	23535729, 25751625, 29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma in Situ	Carcinoma in situ	Pubtator	28374866	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24126923, 25777963, 27671527, 31138322, 31358938		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27818477	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	27818477		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27818477		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29295851		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	31800133		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19476019, 19494522		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8390539		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26921445		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28967680, 30230666, 30551588, 31129929		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27671527		★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	23273104		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	16940744		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	10997688		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27709813		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	8660983, 8792829		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16159638, 16940744		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21470319		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26337663	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28408386		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28967680, 30230666, 30551588, 31129929		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	38573265	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	23353785, 26125859		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	31178742		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30924565		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	26125859		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	18052965, 27818477		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	27818477	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24412470		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29285302		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29985717		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	28374866	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	38003617	Associate	★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	28406931		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18444243		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29113224, 30526680		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	21339636		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	21339644		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18052965, 20140011, 21367814, 28371471, 30183357		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26125859		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30503506		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28408386		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25546329		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14662653, 28464854, 29103029, 29552132		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	23535729		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24126923, 25777963, 31138322, 31358938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27671527		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29552132		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23109837, 24336162, 26921445, 27671527, 29113224		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26921445		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14662653, 9840926		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20178651	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28848066		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	20178651	Associate	★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	10878669		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15153541, 20070602, 27091308, 29141799		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	33098490	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21454294		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19424580, 22081375, 24126923, 24336162, 25777963, 27413764, 27671527, 28771750, 29103029, 29399413, 31076549, 31078776, 31227543, 31669380		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23345134		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24126923, 31138322		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28583714		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	27671527		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28583714		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31078776		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27709813		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29552132		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27671527		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29392553		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14985107, 15565336, 22290466, 22353209, 23406933, 25899833, 30730912, 31044630		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	19480659		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	20178651	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	25899833		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	27102916		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24126923		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	17543081		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28103916		★☆☆☆☆ Found in Text Mining only