SLTM (SAFB like transcription modulator)

Gene

• Entrez ID: 79811
• Gene name: SAFB like transcription modulator
• Gene symbol: SLTM
• Synonyms (NCBI Gene): Met
• Chromosome: 15
• Chromosome location: 15q22.1

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1401798992	G>C,T	Likely-pathogenic	Downstream transcript variant, non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021156	hsa-miR-186-5p	Sequencing	20371350
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT1370171	hsa-miR-148a	CLIP-seq
MIRT1370172	hsa-miR-148b	CLIP-seq
MIRT1370173	hsa-miR-152	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370181	hsa-miR-3647-3p	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370183	hsa-miR-3692	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT1370189	hsa-miR-4436b-5p	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370194	hsa-miR-4766-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370197	hsa-miR-495	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT1370203	hsa-miR-518d-5p	CLIP-seq
MIRT1370204	hsa-miR-519b-5p	CLIP-seq
MIRT1370205	hsa-miR-519c-5p	CLIP-seq
MIRT1370206	hsa-miR-520c-5p	CLIP-seq
MIRT1370207	hsa-miR-526a	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT1370214	hsa-miR-618	CLIP-seq
MIRT1370215	hsa-miR-629	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT1370216	hsa-miR-154	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370217	hsa-miR-2355-5p	CLIP-seq
MIRT1370218	hsa-miR-300	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370219	hsa-miR-381	CLIP-seq
MIRT1370220	hsa-miR-4286	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT1370222	hsa-miR-4696	CLIP-seq
MIRT1370223	hsa-miR-4699-3p	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370224	hsa-miR-520d-5p	CLIP-seq
MIRT1370225	hsa-miR-524-5p	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT1370216	hsa-miR-154	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370181	hsa-miR-3647-3p	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT2109918	hsa-miR-3929	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT2109919	hsa-miR-4325	CLIP-seq
MIRT2109920	hsa-miR-4419b	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT2109921	hsa-miR-4478	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT2109922	hsa-miR-4680-5p	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT2333265	hsa-miR-106a	CLIP-seq
MIRT2333266	hsa-miR-106b	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT2333267	hsa-miR-17	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT2333268	hsa-miR-20a	CLIP-seq
MIRT2333269	hsa-miR-20b	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT2109919	hsa-miR-4325	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT2333270	hsa-miR-519a	CLIP-seq
MIRT2333271	hsa-miR-519b-3p	CLIP-seq
MIRT2333272	hsa-miR-519c-3p	CLIP-seq
MIRT2333273	hsa-miR-519d	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT2333276	hsa-miR-93	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT2627529	hsa-miR-1323	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT2627530	hsa-miR-4461	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370222	hsa-miR-4696	CLIP-seq
MIRT2627531	hsa-miR-4731-3p	CLIP-seq
MIRT2627532	hsa-miR-4801	CLIP-seq
MIRT2627533	hsa-miR-515-5p	CLIP-seq
MIRT2627534	hsa-miR-539	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2627535	hsa-miR-548o	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT2627536	hsa-miR-580	CLIP-seq
MIRT2627537	hsa-miR-606	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT2627538	hsa-miR-942	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT2627529	hsa-miR-1323	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT2691346	hsa-miR-3926	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT2691347	hsa-miR-433	CLIP-seq
MIRT2627530	hsa-miR-4461	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT2109922	hsa-miR-4680-5p	CLIP-seq
MIRT2627531	hsa-miR-4731-3p	CLIP-seq
MIRT2627532	hsa-miR-4801	CLIP-seq
MIRT2691348	hsa-miR-494	CLIP-seq
MIRT1370197	hsa-miR-495	CLIP-seq
MIRT2691349	hsa-miR-513a-3p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT2627533	hsa-miR-515-5p	CLIP-seq
MIRT2627534	hsa-miR-539	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2627535	hsa-miR-548o	CLIP-seq
MIRT2691350	hsa-miR-548s	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT2627536	hsa-miR-580	CLIP-seq
MIRT2627537	hsa-miR-606	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT2691351	hsa-miR-659	CLIP-seq
MIRT2627538	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0050684	Process	Regulation of mRNA processing	IBA

Other IDs

• MIM: 620992
• HGNC: 20709
• e!Ensembl: ENSG00000137776

Protein

• UniProt ID: Q9NWH9
• Protein name: SAFB-like transcription modulator (Modulator of estrogen-induced transcription)
• Protein function: When overexpressed, acts as a general inhibitor of transcription that eventually leads to apoptosis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02037	SAP	22 → 56	SAP domain	Family
  PF00076	RRM_1	386 → 456	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Sequence:

  MAAATGAVAASAASGQAEGKKITDLRVIDLKSELKRRNLDITGVKTVLISRLKQAIEEEG
  GDPDNIELTVSTDTPNKKPTKGKGKKHEADELSGDASVEDDAFIKDCELENQEAHEQDGN
  DELKDSEEFGENEEENVHSKELLSAEENKRAHELIEAEGIEDIEKEDIESQEIEAQEGED
  DTFLTAQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAED
  DNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMN
  ANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSSTGASGQAKSSSKESKD
  SKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNAR
  SPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSR
  SSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKDEKNDNGASGQTSESI
  KKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYR
  RKEILPFEKMKEQRLREHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERL
  QRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIAREREELRRQQQQLRYEQ
  EKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFP
  ESSAVQSSSFERRDRFVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRE
  SDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKSEGSMSTDKRETRVER
  PERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRD
  TSGPRKEWHGPPSQGPSYHDTRRMGDGRAGAGMITQHSSNASPINRIVQISGNSMPRGSG
  SGFKPFKGGPPRRF

• Sequence length: 1034

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Jeune thoracic dystrophy	Likely pathogenic	rs1401798992	RCV000755166	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASPERGER SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	23354516		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	22683780		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	22683780		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11523050, 18379349, 19096300, 20107422, 21687954, 21872356, 22042947, 22052229, 22198430, 22207554, 23780687, 24124150, 24212721, 24742823, 24913906, 25326232, 25492085, 25886066, 25924988, 25938344, 26183759, 26791796, 27022036, 27845189, 27926778, 28024693, 28098570, 28214200, 28285687, 28315738, 28322191, 28418914, 28742836, 28838386, 28952227, 29489023, 29502124, 29631966, 29805710, 29973234, 30015159, 30737213, 31106127, 31200831, 31329925, 7539865, 7866999, 8440743		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15720819, 16186806, 16426920, 17062664, 17132227, 17459054, 18093943, 18172343		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	20934974, 22042947		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15720819, 16186806, 16320248, 17062664, 24742823, 27636117, 29223420, 29600377, 31085800, 31772236		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	29641976		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11290563, 12419829, 16322249, 19010923, 19096300, 19817696, 20150826, 20934974, 21733594, 23995859, 24212721, 24842595, 25273224, 25344360, 25886066, 25971939, 26098749, 26104764, 26547802, 26791794, 26791796, 26892698, 27494877, 27615396, 27696172, 27987579, 28024701, 28141869, 28212540, 28806950, 28914263, 28952227, 29139039, 29225472, 29284707, 29411527, 29571987, 29855336, 30015159, 30327151, 30583073, 30824185, 30885356, 31200822, 31382039, 31739500, 31809977		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	29069852		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	20934974, 22042947		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	21478826, 21983935		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	20934974, 22042947		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	20934974, 22042947		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	15590419, 18172343		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	24124150		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	16863504, 24124150		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	16863504		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	28196027		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	25087088		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25087088, 35462410	Associate	★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	20423996, 23379953, 29135973, 31338678		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	2323775		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29720369		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18992144, 19047176, 22447520, 23386689, 25163932, 25391241		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	1776845		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16909099		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	18813782		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	25923130, 28954282		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	27840956, 29567632, 9721857		★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	17283122, 19472090, 21552147, 28945796, 29216400		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18786162	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20593467, 24384148	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	26754172		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	12707786		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19595710		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	25135958, 29140741		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	15767811		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	20661229		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15767811, 31040922		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	28859123	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24337769		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	24939847	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	34303217, 34677235	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30343272, 31072019, 31311829, 31584260		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	24247044	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	26806347		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	25923130, 28954282		★☆☆☆☆ Found in Text Mining only
Aplasia of Lacrimal and Salivary Glands	Aplasia of lacrimal and salivary glands	Pubtator	25899808	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	25516436		★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Arthrogryposis	Pubtator	30777867	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22416915, 30667542		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10063359, 11296484, 22672415, 30996153, 39357189	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20068183, 22672415, 23242283, 30996153		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31519947		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	36341343	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	19360663, 19548256, 22958829, 23097380, 24150225, 24240654	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	21832174	Inhibit	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17696172, 19255034, 19360663, 19548256, 19732764, 21328570, 21832174, 22833194, 22958829, 23097380, 24150225, 24240654, 24909855, 26728565, 27837921, 29484150, 30304576, 30799683		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	17053076, 19002214, 19255034, 19548256, 19681062, 19732764, 20080979, 21328570, 22110649, 22558359, 22833194, 24150225, 24290385, 24909855, 27086544, 27837921, 29190358, 30914448, 31746037		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	17053076, 21328570		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	17053076, 19002214, 19548256, 20080979, 21832174, 22110649, 22558359, 22833194, 22958829, 23097380, 27086544, 28507316	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	17696172		★☆☆☆☆ Found in Text Mining only
Autosomal recessive non-syndromic sensorineural deafness type DFNB	Non-Syndromic Sensorineural Deafness	Orphanet			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29484431		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	15720819, 32373217	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10867643		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of stomach	Benign Neoplasm Of Stomach	CGI_DG			★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	9772281		★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	7573364	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	29578146		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	27136744, 32447492, 37326363	Associate	★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	22506988		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15870710, 20421991, 24853099, 26225770, 28013036, 28837140, 29684419, 30138038, 31554791, 31808751		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	23431957, 25990623, 28334277	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	10867643, 7862451		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	25418580	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19047176, 23386689, 24748276, 29164057, 30343896, 30725423		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19773441, 20200025, 20489150, 27693535, 29923182, 33335011, 34812554, 36749292	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31811234	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11489839, 12793903, 14734471, 15738393, 16288120, 16596233, 17178829, 18316611, 18499206, 18564920, 19357348, 19567831, 19617568, 19680614, 20687930, 22027690, 23063927, 23825050, 24615768, 24786206, 25002612, 25065564, 25605252, 26100884, 26934743, 27214240, 27488523, 27576528, 28151481, 29042798, 29925897, 30004628, 30079142, 30144023, 30444219, 30949414, 30962283, 31266372, 31541381, 7564388, 8934547, 9221809, 9554529		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12475979, 12673709, 12793903, 17244359, 17260003, 18160707, 18381931, 18499206, 18564920, 20042668, 20460509, 21692045, 22105362, 22374333, 22379025, 22850551, 22869872, 22945653, 23049908, 23063927, 23825050, 24150964, 25065564, 25492484, 25978366, 26934743, 27055285, 27175600, 27576528, 28334277, 28371195, 30004628, 30144023, 30314527, 30444219, 30518672, 30850363, 30962283, 30962452, 31575382, 31695034, 31811234, 32188473, 32348852, 35085554, 35621626, 38238761, 39742369, 8546209	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26968553, 30004628	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33108409	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	23308200, 32188473	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	21733594, 21872356		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	8289471		★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	30360560		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11073815, 15154624, 15839837, 16189274, 16609989, 16804974, 17786187, 18709663, 19096300, 19109251, 21489997, 22251819, 22629406, 22640970, 23449277, 23469222, 25220207, 25633809, 26402720, 27136744, 27244893, 28061464, 29145039, 31744884, 34830011, 35101055, 35645542, 39265740, 8440743, 9876767	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36433941	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10327054, 10734314, 10752688, 10867643, 11810045, 1333188, 1334253, 14719064, 15026993, 16863504, 1719465, 17260003, 1917129, 20736805, 21500189, 21751142, 21983935, 22198430, 22447520, 22644302, 23242174, 23807774, 24853099, 25820598, 26238631, 27894094, 27917934, 28259294, 28284101, 28285687, 28829837, 29633423, 29973234, 30032818, 30144023, 30149144, 30455128, 30909397, 31284422, 31472177, 8208549, 8289471, 8344755, 8863670, 9140397, 9731534, 9815967		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	10702398, 18059365, 25844809, 32487254	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	20661229		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25899808, 25923130, 32964978, 33172898	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	29920512	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	17244359	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11854908, 19140237, 19447220, 19490101, 20501828, 21572247, 21658389, 21737452, 22418436, 22912725, 22962849, 23006961, 23552472, 24516705, 24614035, 25148256, 25591763, 25620570, 25633810, 25874493, 26000702, 26159278, 26259250, 26695141, 26790028, 27077227, 27468214, 27579536, 27813498, 28122337, 30373752, 30663411, 31115495, 31363003, 32100822, 32516967, 32716114, 32724815, 32879217, 32980960, 33155201, 33824476, 33972742, 34059694, 34543520, 35236826, 35428350, 36433941, 37326363, 37433225, 37996058	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27813498	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29256857	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of stomach	Stomach Carcinoma	BEFREE	28836864		★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of stomach	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	17244359, 26496879, 30962452, 33414541	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15870710, 24853099, 26225770, 28013036, 28837140, 29684419, 30138038, 31554791, 31808751		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10770644, 10918387, 11290563, 11795945, 14737093, 15592501, 17332337, 17463250, 18395971, 18672314, 18709663, 18818206, 19088816, 19096300, 19351834, 19393836, 19723643, 19851711, 20008840, 20146583, 20934974, 21062933, 21168239, 21702040, 21716144, 21847121, 22052230, 22133747, 23360489, 23401458, 23592446, 23650389, 23733853, 23801885, 23962905, 23989980, 24033722, 24165158, 24212721, 24297483, 25184262, 25232729, 25273224, 25492085, 25656847, 25777467, 25780909, 26075299, 26547802, 26574927, 26729443, 26791794, 26811313, 27009743, 27014910, 27223439, 27262212, 27343442, 27343443, 27422710, 27450722, 27589834, 27694386, 27716616, 27748920, 27794501, 28024693, 28024701, 28061464, 28198463, 28212540, 28260071, 28294470, 28324883, 28373408, 28396363, 28404966, 28679766, 28765324, 28843992, 28855353, 29020635, 29188469, 29435154, 29568386, 29570930, 29615769, 29664235, 29669758, 29753331, 30542697, 30554986, 30803499, 30813513, 30879923, 31083323, 31104010, 31137515, 31200822, 31227004, 31322230, 31323446, 31342590, 31369639, 31480591, 31524233, 31548343, 31561203, 31564605, 31698509, 31809977		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	10433927, 16014115, 17595760, 35144591, 38250760	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21105966, 24500968, 27259358, 28064436, 28445954, 31284422, 31311829, 31731384, 33204717, 33226369, 34957503, 7573364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10433944, 10454537, 10807693, 12213728, 22198430, 23022995, 23213094, 23219378, 23791828, 23895657, 24000165, 24023729, 24609899, 25087088, 25186085, 25187556, 25564569, 26448928, 26505625, 26636767, 26804638, 26951228, 27894094, 28315738, 28358873, 28418914, 28419182, 28644771, 28974261, 29550566, 29910688, 29978187, 30149144, 30837581, 31034483, 31436251, 31575031, 31994979, 32392161, 32770124, 32811483, 34261695, 34708249, 34801057, 35546143, 35979929, 36162322, 37898101, 38456787	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19723643, 21849853, 22768234, 30279110, 33475256, 33990404, 34171074, 8097369, 8957065	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22052229	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	20934974, 22042947		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	28428108		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	20934974, 22042947		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17308108, 17595760, 20145172, 23467907, 24814316, 27170665, 27917934, 28428108, 28829508, 8077049		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	20661229		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	BEFREE	26847053, 29338938, 30015159, 30089599		★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	24118504, 30466410		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	25782598		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	31369639	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29530797, 31467809		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33126883	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	30731286		★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28547726		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25888626, 28789447, 29058790		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	18055005		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24469707, 25888626, 28789447, 29058790		★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	ORPHANET_DG	9927037		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29720369		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18992144, 19047176, 22447520, 23386689, 25163932, 25391241		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	1776845		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	11895493, 18159174		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16950403, 20565817, 23391413, 23619566, 28192597, 30015968, 30850583		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20565817, 21673683, 24563076, 25536104, 25873560, 26018028, 29740198, 30850583, 32897609	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	12183053, 23320110	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27576314, 29633423, 8863670		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	20041488, 20512480, 24621885, 28272674, 34127734, 34550531	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	20512480, 20617367, 23912551, 24621885, 27016303		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	11014955		★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12378530		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24561793, 28231754		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	22416915		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	20416453		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16627020, 30099441		★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	21478826, 21983935		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	17724745, 22045652, 28950372		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	27894094		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type I	Cockayne Syndrome	BEFREE	30879923		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	20080979		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28468845	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	34601245	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26229399	Associate	★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10944610, 12782608, 12958170, 16158056, 21955323, 22179665, 22495710, 24714091, 24814316, 28810597		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	35645542	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18559601		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20661223	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	32198312	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10878450, 10944610, 10959552, 1333188, 16863504, 16953230, 17016432, 18395971, 20965291, 21609022, 21970370, 22179665, 22343615, 22751462, 22936063, 23704319, 23729478, 23876834, 24122793, 24200637, 24863535, 24931611, 25090459, 25244939, 25381815, 25427200, 25976417, 26026086, 26159851, 26503729, 26515696, 27325282, 27585117, 27793046, 28120416, 28377632, 28459362, 28654634, 28764718, 28810597, 28886275, 28978055, 29200829, 29427222, 29581707, 29589299, 29641976, 30556647, 30863492, 31629952, 31778267, 9437998, 9815967		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10944610, 11073815, 16237757, 18395971, 20032439, 20233444, 20661223, 21098338, 21955323, 21970370, 22936063, 23194063, 23532910, 23573286, 23580180, 23704319, 24205104, 24425103, 24500024, 24504536, 24714091, 24863535, 25090459, 25220207, 25244939, 25306394, 25945841, 26026086, 26159851, 26459369, 26553611, 26951228, 27421137, 27780856, 27793046, 28086832, 28209746, 28377632, 28654634, 28764718, 29463215, 29576428, 30556647, 30720004, 30723303, 30897285, 31778267, 31782259, 32800944, 33245030, 33581651, 33951261, 34428346, 34911835, 35544729, 35551547, 35645542, 35785488, 36672275, 36921315, 36931635, 37386758, 37821801, 37870214, 38212428, 40211189	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12856716, 15672865, 15849510, 16158056, 16278380, 16953230, 18258742		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	22838389, 24124150, 9815967		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	26358176		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23619566, 30015968		★☆☆☆☆ Found in Text Mining only
Congenital melanocytic nevus	Congenital Melanocytic Nevus	BEFREE	11209133		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10022739, 10535327, 12351585, 12647800, 14713848, 15448018, 15930277, 16585196, 16914575, 19402075, 21228928, 23219378, 24000165, 24767687, 24929890, 25186085, 26364599, 26505625, 26951228, 27453294, 27894094, 28417541, 28427859, 28550387, 29890660, 30017898, 30478013, 30999623, 31184937, 31554440, 31582532		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Copper-Overload Cirrhosis	Copper-Overload Cirrhosis	CTD_human_DG	22879914		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30993313		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30993313		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30993313		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	20416453		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31506424		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	2210755, 2563631, 2563632, 2569290, 2589321, 2613227, 2879438, 2886421, 2888722, 2888841, 2892400, 2892401, 2900520, 3026171, 3026172, 3026173, 3282234, 3467587		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	2563631, 2563632, 2589321, 2851537, 2879438, 2879439, 2879440, 2888841, 2892400, 3026171, 3026172, 3130752, 3282234, 3467586, 3467587, 3467589	Associate	★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	25941349	Associate	★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE (disorder)	Deafness	BEFREE	31801140		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 97	Deafness	UNIPROT_DG	25941349		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 97	Deafness	BEFREE	31801140		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 97	Deafness	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11508578		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	34601245	Stimulate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30114544		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	30996153	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	24384148	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	25119929	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27086544	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21866211, 28847847, 30993313, 31019977, 31250416		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19933191, 21866211, 25446319, 32094377, 33181273	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21866211, 28847847, 30993313, 31019977, 31250416		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	31396209	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32094377	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28318105		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19943796, 28857451, 29058235, 29530797, 30614616, 31043135, 31096578, 31737069		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28819999, 30143691	Associate	★☆☆☆☆ Found in Text Mining only
Diaphanospondylodysostosis	Diaphanospondylodysostosis	Pubtator	29910688	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	40461383	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	15767811		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	16189274, 20423996, 23379953, 23745832, 29135973, 29876933, 31338678		★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Distal myopathy	Pubtator	29630524	Inhibit	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	28644771, 32240796, 35466070, 40461383	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	27840956		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16681770, 17595299, 18497076, 29630089, 29633423, 30277666		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12524084, 16681770, 22617129, 29630089, 31686413, 31992589, 32412912, 34431253, 37730563	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18497076		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	12524084, 21983935, 23469222	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21983935		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	1776845		★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa simplex Ogna type	Epidermolysis bullosa	Pubtator	28675510	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	37812383	Stimulate	★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	15156160		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17595760, 20145172, 27170665		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	25899808		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17062664, 26895097, 27636117, 29223420, 29285246, 30454012		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17062664, 26895097, 27636117, 29223420, 29285246		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	17062664, 22976495, 30569129, 32495982, 35242498	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	22042947		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20534479, 22450065, 23426935, 25588551, 26036285, 26810066, 28459198, 34217156, 35242498	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34037097	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	24742823	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	19546379	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25119929, 31621900		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22450065, 29223420, 31772236		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	17704785		★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	33382535	Associate	★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	20639860, 30126419		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	10825143, 15067326		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	38092180	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	27401892, 30069449		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	9394725		★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	12114431		★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	BEFREE	31205468		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	19548256, 36944506	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	26375439	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21171987, 25836719, 27163723, 28377632, 29204252		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	25557174	Associate	★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	22162573		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10389763, 11238734, 16106403, 22020333, 22203985, 22323597, 22672415, 22738909, 23258844, 23359207, 23386689, 23695554, 24440911, 24457079, 24911613, 25135958, 26250785, 26381735, 26637806, 26700818, 26946354, 27566180, 27748748, 28258444, 28504721, 28668888, 28751462, 28960893, 29164057, 29238047, 29348487, 29743557, 30201763, 30613151, 30760737, 30982841, 31221203, 31349699, 31423264, 31694905, 7534113, 8017863, 8280494, 8647632, 9402967		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11238734, 18973197, 22203985, 22323597, 24362532, 24518591, 25135958, 25754088, 25762646, 25825051, 26498130, 26637806, 27172220, 29238047, 29444745, 30108175, 30497369, 30760737, 30886866, 31000415, 31502574, 31776899, 33727583, 34667077, 35332262, 36972629, 7556648	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	19190120		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CTD_human_DG	22162573		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22672415, 31575848	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10389763, 11238734, 22020333, 22203985, 22323597, 22672415, 22738909, 22789536, 23258844, 23359207, 23386689, 23695554, 24115218, 24440911, 24457079, 24518591, 24911613, 24951116, 25135958, 25374033, 26250785, 26381735, 26700818, 26946354, 27566180, 27748748, 28258444, 28504721, 28668888, 28751462, 28960893, 29164057, 29238047, 29348487, 29743557, 30201763, 30613151, 30760737, 31349699, 31423264, 31694905, 7534113, 8017863, 8280494, 8647632		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	22162573		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11007037, 20233866, 22750473, 26097553, 26823824, 26845757, 27748748, 28751462, 28965162, 29175980, 30062604, 30343896, 30519867, 30996153, 31221203, 7534113, 8017863, 8647632		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11296484, 16082194, 18077431, 18992144, 19773441, 20157762, 20190569, 20200025, 23577178, 23619925, 24362532, 25135958, 25762646, 25935522, 26654598, 26823824, 26879272, 27385209, 28965162, 29718398, 30996153, 31381204, 31554817, 32238360, 33268783, 33645009, 34667077, 34812554, 35100091, 37349135, 37503880, 39265740, 7556648, 9263534	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15516982		★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	32014051	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIB	Glycogen storage disease	Pubtator	34320421, 35739536	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIC	Glycogen storage disease	Pubtator	16014115	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	25087088	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	36627004	Associate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	15292926, 20558345, 39510033	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	19318576, 26832731, 30694565		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	17260003, 19639388, 23213056, 26572163, 32102486	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	9065649		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	25941349	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	14625827		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	25844809		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	25844809	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	28418914	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	21445055		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	21992464	Associate	★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	29256857		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19940359, 30206415	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	22042947, 22729845		★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	11753639, 17696172, 18004740, 18083897, 24714091, 25163932, 29058790, 29893934, 30649748		★☆☆☆☆ Found in Text Mining only
Hereditary Papillary Renal Carcinoma	Hereditary Papillary Renal Carcinoma	BEFREE	10327054, 10535326, 11007037, 11593422, 12050491, 12460923, 15371818, 15448018, 15579033, 16434318, 17255292, 19285230, 19402075, 22717761, 9563489, 9731534		★☆☆☆☆ Found in Text Mining only
Hereditary Papillary Renal Carcinoma	Hereditary Papillary Renal Carcinoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Hereditary papillary renal cell carcinoma	Hereditary Papillary Renal Carcinoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINGEN_DG	26700204		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	17724745		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11159538, 2323775, 8289471		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11159538, 22180430, 23558571, 25916750, 9028331	Associate	★☆☆☆☆ Found in Text Mining only
Holt-Oram syndrome	Holt-Oram Syndrome	BEFREE	2300559		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	35690785	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	27694386	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18701880, 19398658, 21694735	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30928957		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	18701880	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29530797		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	12726861, 18422749, 26018028, 29855336	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17406354, 22383739, 22761861, 23696831, 23927384, 26018028	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36211385, 37812383	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10698493, 30711629, 31037160		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29843126		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35645542	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36627014	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	25565142		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	28374784		★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Intestinal perforation	Pubtator	23379953	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	28272703		★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Jeune thoracic dystrophy	Jeune Thoracic Dystrophy	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	24983965, 30143691	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30143691	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12378530		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	10647647, 10843148, 12907635, 9731534		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	10491015, 23038766, 26448928, 28787086, 32083993, 36138026, 37326363, 37898101, 38456787	Associate	★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	29700339	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	30993313		★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Leigh syndrome	Pubtator	28608966	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	27900663		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17673463, 24561793, 36534523	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8289471		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18252861, 23233446, 31638252, 34193978, 34789086, 36534523	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12550762, 22683780, 29970518, 8289471		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	22683780		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16909099		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	24337769		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	29617836		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	24608056, 29617836		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	31126284	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	20522586	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	26006023		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10713700, 10925356, 11381087, 14605670, 16082194, 16331686, 17785413, 19234449, 19447220, 21445055, 21737452, 21949730, 22418436, 22641068, 23295441, 23593387, 23832667, 24045150, 24222167, 24992910, 25058462, 25607934, 25633810, 25874493, 25908454, 26160430, 26351320, 26458953, 27196749, 27813498, 28122337, 28246274, 28587113, 28604110, 28714063, 28954551, 29085209, 29163834, 29256857, 29467897, 29625879, 29712569, 29972759, 30573522, 30663411, 30711629, 30737831, 30952770, 30953666, 31119488, 31142504, 31186768, 31206197, 31645479, 31785057, 31846974, 8276372, 9010472, 9096589, 9927037		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16331686, 16710476, 17992475, 19065669		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	UNIPROT_DG	9927037		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16627020, 30099441		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	16216128	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	30031724, 9286233		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35236826	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	9286233		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	16627020		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20596656, 22326218, 30529386, 30711629, 7989714		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	35236826	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	12177240, 39217894	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37812383	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	14737093, 18093943, 18709663, 19723643, 23345546, 24200637, 27223439, 27794409, 28024693		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17332337, 17463250, 18379349, 19037978, 19096300, 19139719		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18093943, 18395971, 18709663, 19096300, 19117057, 19351834, 19723643, 19817696, 20736805, 21043826, 21706050, 21847121, 23087254, 23360489, 23650389, 23801885, 24200637, 24236184, 24285539, 24627222, 24638075, 24662823, 25011627, 25477232, 25638566, 25656847, 25834821, 25869878, 26811313, 27009743, 27223439, 27343442, 27343443, 27396618, 27694386, 27896996, 28061464, 28198463, 28212540, 28294470, 28914263, 29570930, 29615769, 30165371, 30459450, 30615629, 30639620, 30879923, 31096000, 31182981, 31228623, 31279006, 31369639, 31480591, 31606039, 31862577, 31932802, 32086345, 32240796, 32964978, 33172896, 33402590, 33407425, 33574356, 33893079, 33896820, 33905998, 34234236, 34516823, 34677235, 34731623, 34812554, 35628590, 35643725, 35718095, 35900560, 35961935, 36927974, 37059804, 37183231, 37326363, 37468447, 37762506, 37812383, 37821451, 37897706, 38198957, 38271745, 38307867, 38369190, 39528978, 8349603	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	20934974		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31104010	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	10861506, 12941820		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	12793903, 15154624, 16014115, 19140237, 21779788, 23532910, 23812675, 23927384, 25364819, 25592281, 26968553, 28235401, 28590585, 29360662, 30897285, 33655604, 34152098, 35650563	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19940359, 22640970, 24393368, 35650563, 37832054	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	29426936		★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	18564920, 22351697	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10487611, 27609791, 29876933, 8289471		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	1829952	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18813782		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37657032, 9028331	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	28231754		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	15520843		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	27900663		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	22242671, 25862637		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	19318576, 26832731, 30694565		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	11572935, 21774103, 26765063, 29209570		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	27705913, 28100259		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	30725423, 31694035		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11489839, 12793903, 14734471, 15738393, 16288120, 16596233, 17178829, 18316611, 18499206, 18564920, 19567831, 19617568, 19680614, 20687930, 22027690, 23063927, 23825050, 24615768, 24786206, 25002612, 25065564, 25605252, 26100884, 26934743, 27214240, 27488523, 27576528, 27775073, 29042798, 29925897, 30004628, 30079142, 30144023, 30444219, 30597648, 30949414, 30962283, 31266372, 31541381, 7564388, 8934547		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16681770, 17595299		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17062664, 22751462, 24742823, 26895097, 27636117, 29223420, 29285246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	22042947		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28075018, 28374784		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	11042681, 12907635, 15579033, 19402075, 20059341, 24359990, 26951228, 30909397, 9258068		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21445055, 21949730, 28377632, 30711629, 30786811, 31524233, 9927037		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10770644, 10918387, 11290563, 14737093, 15592501, 17332337, 17463250, 18395971, 18672314, 18709663, 18818206, 19088816, 19096300, 19117057, 19351834, 19393836, 19723643, 19851711, 20008840, 20126411, 20146583, 20934974, 21062933, 21168239, 21702040, 21716144, 21847121, 22052230, 22133747, 22157681, 22552292, 23360489, 23401458, 23448368, 23592446, 23650389, 23733853, 23801885, 23962905, 23989980, 24033722, 24165158, 24212721, 24286402, 24297483, 24458568, 25184262, 25232729, 25273224, 25492085, 25656847, 25777467, 25780909, 25938344, 26075299, 26547802, 26574927, 26729443, 26791794, 26811313, 26879245, 27009743, 27014910, 27022036, 27223439, 27262212, 27343442, 27343443, 27422710, 27450722, 27589834, 27694386, 27716616, 27748920, 27786612, 27794501, 28024693, 28024701, 28061464, 28198463, 28212540, 28260071, 28294470, 28324883, 28373408, 28396363, 28404966, 28679766, 28765324, 28806950, 28843992, 28855353, 29020635, 29114476, 29188469, 29435154, 29568386, 29570930, 29615769, 29664235, 29669758, 29753331, 30165371, 30352902, 30542697, 30554986, 30803499, 30813513, 30879923, 31083323, 31104010, 31137515, 31200822, 31227004, 31228623, 31322230, 31323446, 31342590, 31369639, 31480591, 31524233, 31548343, 31561203, 31564605, 31698509, 31809977		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	20934974		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	24608056, 29617836		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12915129, 17308108, 21478826, 23467907, 24814316, 27170665, 28428108, 28829508, 8077049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	20661229		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10975866, 12594808, 19651775, 20869080, 22815748, 25451256, 26667487, 28498406, 29100344, 29229329, 29709702, 31072019, 7866999		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10875259, 11948964, 15327888, 16956884, 20085644, 22110593, 23526299, 23922103, 25087088, 25381262, 25449774, 25862631, 26806347, 27105539, 27189666, 27539855, 27779203, 27915273, 28235401, 28510291, 29088840, 29457496, 30083962, 30401749, 30568225, 31819003, 7539865, 9772281		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	23242174		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27330186		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11966534, 12620387, 1333188, 14719064, 18395971, 21393565, 21424128, 22042954, 22606006, 22644302, 22729845, 23327903, 23807774, 23812675, 24118504, 24223894, 24416238, 24518603, 24837198, 25157953, 25203738, 25584489, 25653235, 25881479, 25882375, 25927670, 26033401, 26049023, 26125303, 26136075, 26238271, 26404902, 26528757, 26690587, 27185371, 27197184, 27401892, 27437872, 28052014, 28314274, 28836864, 28881678, 28968267, 29435059, 29435981, 29510730, 29630524, 29790169, 30158543, 30466782, 30511201, 30980196, 31395059, 31499745, 31799656, 7664243, 8988842		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	22042947, 22729845		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24170771, 28757314, 30463570		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	30233210		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15870710, 24853099, 26225770, 28013036, 28837140, 29684419, 30138038, 31554791, 31808751		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10435641, 10825143, 11029504, 11296484, 11328532, 11559554, 11705871, 11795945, 12460923, 12620387, 14627992, 15319714, 15738393, 15767811, 15772665, 16050800, 16189274, 16227611, 16715130, 16896265, 16953230, 17260003, 17463250, 17703498, 18395971, 18549337, 18709663, 18992144, 19015641, 19096300, 19402129, 19534520, 19638428, 19658182, 19808904, 20031486, 20146583, 20421991, 20462834, 2052572, 20661229, 20670955, 20841479, 20868306, 21102609, 21212418, 21266357, 21464397, 21500189, 21540561, 21697284, 21831840, 22110593, 22184289, 22203985, 22270953, 22447520, 22566105, 22617325, 22682129, 22975805, 23242174, 23386689, 23427294, 23548264, 23695554, 23812675, 23876834, 24061647, 24168187, 24173966, 24266843, 24359990, 24371262, 24440911, 24662823, 24706440, 24742823, 24814316, 24853099, 24863535, 24865428, 24986519, 24997156, 25065564, 25087088, 25305631, 25326232, 25451256, 25504634, 25522678, 25584489, 25862637, 25908454, 25940717, 25985180, 25987653, 26082439, 26243862, 26250899, 26254225, 26330547, 26339654, 26351321, 26375439, 26402720, 26432108, 26445453, 26483207, 26674534, 26729443, 26765781, 26795575, 26806347, 26879245, 26951228, 26992846, 27009743, 27036042, 27136744, 27170665, 27185371, 27196782, 27325282, 27330186, 27422720, 27524418, 27655711, 27794501, 28064454, 28098570, 28164087, 28164088, 28164090, 28214200, 28231754, 28341789, 28371195, 28376232, 28396313, 28427506, 28460431, 28485003, 28489587, 28532501, 28603720, 28634201, 28669750, 28765324, 28789447, 28827556, 28855353, 28902178, 28950372, 28958504, 28973403, 29045907, 29046141, 29130105, 29188469, 29194580, 29293502, 29363547, 29376210, 29532159, 29532558, 29551767, 29618618, 29674709, 29717265, 29730462, 29731973, 29866143, 30174307, 30208970, 30289981, 30361332, 30404949, 30454012, 30463996, 30550851, 30643210, 30646583, 30649699, 30649748, 30670153, 30674502, 30700325, 30725423, 30760737, 30786811, 30918522, 30930049, 30962283, 31119488, 31200835, 31296956, 31323446, 31391294, 31480591, 31512514, 31584260, 31606039, 31729060, 31783719, 31785057, 9772281		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21196210, 21540237, 29720369		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	25348954		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25888626, 28789447, 29058790		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10944610, 12782608, 12958170, 16158056, 21955323, 22179665, 22495710, 24658599, 24714091, 28810597		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12793903, 14509156, 18316611		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20889649, 24318467		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	30126419		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	28675510		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	23780998, 24266843, 26013381, 28817373, 29219214		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18059365, 18992144, 19244381, 25163932, 26496080	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18992144, 19047176, 22447520, 23386689, 25163932, 25391241		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17371876, 19422607, 20164465, 21654344, 21703345, 22045652, 22570180, 22763439, 22948084, 23802768, 24443471, 25531327, 25746038, 25910030, 26013381, 28064454, 28147313, 29045509, 29719603, 30526855		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19032678, 20067553, 20164843, 20520718, 21654344, 22020736, 22241959, 22763439, 23203808, 24372645, 24443471, 26826285, 27689874, 31638339, 31877948, 33451139, 37377890, 37506884, 39528978, 8104462	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	29426936		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29923182	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31745173	Associate	★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	BEFREE	11209133		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20200025, 38066633	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29613985		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11493335, 16299245, 18672314, 19834061, 21132014, 28560410, 29209570		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	17872495, 22065079, 24762959, 28560410, 31709947, 35319795, 36683050	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	17872495, 21774103, 25756049, 27705913, 31752449, 36683050	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34059694	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24136779, 28082000, 29482601		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28103611		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30401749		★☆☆☆☆ Found in Text Mining only
Micronodular cirrhosis	Micronodular cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	20522586		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	22605650		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	25288793	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	BEFREE	14648149		★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Mitochondrial myopathy	Pubtator	24711008	Associate	★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	23431957		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	35645542	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	28428108		★☆☆☆☆ Found in Text Mining only
Multiple fibrofolliculomas	Multiple Fibrofolliculomas	BEFREE	10522666, 12907635		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11830493, 16189274, 18205859, 18509644, 19187270, 23431957, 24326130, 24450886, 29765374, 30353654, 32198978, 8916966	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12682635		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16189274, 17179234, 17942923, 18205859, 18509644, 23431957, 23952536, 24450886, 25967746, 28337527, 29521056, 30353654		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30996153	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	24711008	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	24674452, 2803976		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	24378265	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	10598900	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11399246		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	19471602		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	19471602, 24766640	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	12707036	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	20819464, 22416915	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	22416915	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11438450, 11809714, 18789327, 25611392, 25965822		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	23573286, 24722284, 25965822	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	18789327, 21057531, 24722284	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	32240796, 39362249, 40461383	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	33108409	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10359528, 10389764, 10487611, 10651314, 10685632, 10760755, 10812167, 10815826, 10861506, 10867643, 10918387, 10959094, 10975866, 11559554, 11705871, 11809714, 12050491, 12114431, 12460923, 12538453, 12620387, 12646256, 12941820, 14559814, 14719064, 14737093, 14991901, 15026993, 15067326, 1520484, 15261142, 15485908, 15526350, 15738393, 16245927, 16288120, 16458257, 16627020, 16651428, 16914575, 17108099, 17115441, 17283122, 17308108, 17525527, 17525679, 17595760, 17684486, 18093943, 18262049, 18497076, 18511928, 18672314, 18709663, 18785203, 19015641, 19047176, 19074879, 19117057, 19234449, 19321255, 19402075, 19435874, 19472090, 19502802, 19589612, 19738115, 20031486, 20104519, 20150826, 20164465, 20233866, 20462834, 20500904, 20512480, 20522586, 20639860, 20739887, 20868306, 21062933, 21105966, 21220347, 21248300, 21252284, 21383285, 21393565, 21400509, 21464397, 21478826, 21552147, 21789719, 21847116, 21847121, 21872356, 21949730, 21983935, 22027690, 22052229, 22052230, 22110593, 22179665, 22203985, 22237262, 22242671, 22323597, 22367914, 22447520, 22552292, 22566105, 22605650, 22750473, 22766670, 22873759, 22936063, 22992338, 23013135, 23242174, 23258844, 23320511, 23386689, 23469222, 23659968, 23695554, 23729478, 23758612, 23812675, 23928995, 23989980, 24033722, 24115218, 24118504, 24121490, 24173966, 24212721, 24258345, 24292963, 24469707, 24491355, 24518591, 24687921, 24710956, 24722154, 24777602, 24804300, 24810547, 24837198, 24853099, 24863535, 24903273, 24913906, 24929890, 24930887, 24970481, 24986519, 24992910, 24997156, 25052479, 25163932, 25232729, 25248999, 25326232, 25364819, 25381262, 25391241, 25416047, 25504634, 25534130, 25556163, 25584489, 25605252, 25612681, 25633809, 25820598, 25834821, 25844809, 25874493, 25888626, 25902175, 25908454, 25971938, 25971939, 25976141, 25985180, 26026086, 26033401, 26041880, 26141986, 26215952, 26238271, 26285778, 26323927, 26330547, 26334838, 26359985, 26364599, 26370161, 26381735, 26404902, 26432108, 26503729, 26515696, 26597578, 26620497, 26636767, 26690587, 26755529, 26765781, 26791796, 26879245, 26923077, 26992846, 26996670, 27067976, 27116183, 27157666, 27169691, 27184134, 27185371, 27196749, 27207013, 27252416, 27330186, 27385209, 27393507, 27421137, 27442811, 27524418, 27550420, 27715452, 27748748, 27775073, 27794409, 27807832, 27917934, 27918764, 27926778, 27959446, 28088230, 28141869, 28192597, 28212540, 28214200, 28260071, 28285687, 28376232, 28417541, 28418914, 28418920, 28559461, 28590585, 28619752, 28638453, 28679766, 28751246, 28751462, 28802255, 28838386, 28855353, 28902178, 28960893, 28961841, 28968967, 29045509, 29045894, 29045907, 29061793, 29086198, 29130105, 29139039, 29145039, 29149761, 29164057, 29237805, 29256857, 29338938, 29376210, 29400604, 29435154, 29444985, 29467897, 29496255, 29674709, 29696715, 29700912, 29712569, 29717265, 29755689, 29866143, 29928341, 29951752, 29967248, 30015159, 30015968, 30144023, 30208970, 30343272, 30348707, 30352902, 30429039, 30459450, 30463570, 30463996, 30513872, 30550851, 30636374, 30694565, 30725423, 30813513, 30824185, 30881919, 30962452, 31065835, 31101918, 31136962, 31206197, 31265190, 31329925, 31338678, 31395059, 31470227, 31472177, 31480591, 31512514, 31541850, 31554440, 31582532, 31584260, 31613934, 31621900, 31629952, 31649529, 31694905, 31752658, 7539865, 7664243, 7728766, 7793316, 7866999, 7927256, 8382008, 8761307, 8863670, 8934547, 9065649, 9258068, 9391119, 9563489, 9815784, 9815967, 9862636		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	18273647		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10456263		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	CTD_human_DG	16051641		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19939254, 22266870, 31137515	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27899382, 27922668, 29515255, 31137515		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	27086544, 27837921, 31746037		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	18992144		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22973954		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	24337769		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Autism	Autism	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30928957		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11795945, 16171945, 18379349, 18672314, 18836087, 19037978, 19117057, 19188161, 19255323, 19353596, 19381876, 19632948, 19804422, 20107422, 20124471, 20126411, 20129249, 20146583, 20154724, 20489150, 20530710, 21687954, 21706050, 21716144, 21982684, 22050016, 22052229, 22157681, 22198430, 22207554, 22237262, 22552292, 23020724, 23345546, 23379755, 23400546, 23401458, 23427294, 23527257, 23536719, 23650389, 23659968, 23794705, 23876834, 23931927, 23989980, 24138716, 24165158, 24167634, 24200637, 24305878, 24355409, 24628993, 24687921, 24710956, 24722154, 24889366, 24922520, 24983493, 25039923, 25052479, 25117641, 25222473, 25226813, 25232729, 25310337, 25413260, 25492085, 25502629, 25522678, 25522765, 25532429, 25534130, 25612681, 25656847, 25777467, 25831463, 25851827, 25893986, 25925948, 26041880, 26104764, 26124204, 26184032, 26215852, 26323927, 26351321, 26358176, 26370161, 26395411, 26402720, 26568289, 26580964, 26729443, 26791795, 26847053, 26892698, 26909600, 26992846, 27022036, 27223439, 27259997, 27393507, 27405684, 27461774, 27606884, 27664533, 27666659, 27693535, 27694386, 27748834, 27770383, 27794409, 27794501, 27856142, 28024693, 28038979, 28098570, 28212540, 28260071, 28285687, 28315738, 28315949, 28322191, 28332364, 28373408, 28396313, 28418914, 28460468, 28469968, 28521430, 28522754, 28554854, 28559461, 28575795, 28590585, 28607809, 28742836, 28756651, 28787156, 28835699, 28838386, 28960893, 28961841, 28968967, 28978110, 29050231, 29088885, 29139039, 29145039, 29285237, 29338938, 29352732, 29416799, 29502124, 29517860, 29570930, 29571987, 29596029, 29618618, 29621416, 29631966, 29738763, 29758406, 29805710, 29848294, 29880877, 29928341, 30015159, 30047303, 30072474, 30089599, 30156984, 30165371, 30188361, 30205166, 30290647, 30309221, 30311833, 30327151, 30352902, 30391211, 30422759, 30477470, 30600919, 30674502, 30676858, 30744539, 30762593, 30791921, 30879923, 30885356, 30940295, 30952716, 31065835, 31106127, 31152452, 31200831, 31200835, 31227004, 31323446, 31329925, 31388026, 31584260, 31605799, 31606039, 31611604, 31613934, 31622732, 31698509, 31807006, 31817278		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	21623265, 21815704, 22787409, 24688052		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	17593080		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	30962452		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	CLINGEN_DG	25941349		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	1776845, 22672415		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	27497264	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal Neoplasm	LHGDN	14627992		★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Osteofibrous Dysplasia	BEFREE	26637977		★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Osteofibrous dysplasia	Pubtator	26637977	Associate	★☆☆☆☆ Found in Text Mining only
Osteofibrous dysplasia	Osteofibrous Dysplasia	Orphanet			★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Osteofibrous Dysplasia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30404181		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10815826, 10867643, 16651428, 19402129, 2052572, 22367914, 23229283, 29045509, 30666838, 30719715, 7862451, 8863670		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	12709413, 14524531		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17786187, 21751203, 22367914, 25880599, 26510912, 29334376, 30666838, 30793707, 31425497	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	CTD_human_DG	22235915		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	8863670	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	23469222		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24814316, 28428108		★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	27917934		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	27599579	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12915129		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17308108, 23467907, 27170665, 28829508, 8077049		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	20661229		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10491015, 21478826, 21983935, 23467907, 23469222, 24447705, 24901400, 24952592, 25658794, 26695152, 26937756, 27599579, 28446239, 28829508, 29099290, 29920310, 30638462, 31540229, 32192774, 38030594	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32295618	Stimulate	★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	16956884		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10975866, 12594808, 19651775, 20869080, 22815748, 25451256, 26667487, 28498406, 29100344, 29229329, 29709702, 31072019, 7866999		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30343272		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	10975866		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12594808		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11259105, 16804974, 18422749, 25451256, 26298849, 26381405, 26910401, 29229329, 31161784, 31284422, 31412643, 31911180, 32537471, 32943033, 33648511, 35077391, 35449152, 36364317, 37108495, 37260110, 37815881, 37832054, 37881431, 9665481, 9665487	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	9665487	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	16804974	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CLINGEN_DG	10433944, 15557554, 15772665, 18055465, 1917129, 9140397, 9326629		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	12213728, 15767811, 16651428, 23213094, 24495452, 24812413, 25779944, 26052049, 26636767, 26718059, 27715452, 28644771, 30466410, 30952639		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	ORPHANET_DG	26536169		★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma	Papillary Renal Carcinoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma, familial	Papillary Renal Carcinoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma, sporadic	Papillary renal carcinoma	CLINGEN_DG	10433944, 15557554, 15772665, 18055465, 1917129, 9140397, 9326629		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	14991901, 15266330, 15526350, 15767811, 16896265, 17703498, 19391129, 21537871, 25868389		★☆☆☆☆ Found in Text Mining only
Pediatric hepatocellular carcinoma	Hepatocellular Carcinoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Pericardial effusion	Pericardial effusion	BEFREE	25157953		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30404181		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	25798586, 25902175, 33655604	Associate	★☆☆☆☆ Found in Text Mining only
Perivascular Epithelioid Cell Neoplasms	Perivascular Epithelioid Neoplasms	BEFREE	28009610		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	19255034, 19360663, 19548256, 24240654, 24909855, 27837921		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	26700204	Associate	★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	20200025	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	25756049		★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	31391294		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	31391294		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	26718059		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	23036804, 36627014	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21042281		★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31675546		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	30032818, 31065835, 31072019, 31436251		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17673463		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	30032818, 31065835, 31072019, 31436251		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10875259, 11948964, 15327888, 16956884, 20085644, 22110593, 23526299, 23922103, 25087088, 25381262, 25449774, 25862631, 26806347, 27105539, 27189666, 27539855, 27779203, 27915273, 28235401, 28510291, 29088840, 29457496, 30083962, 30401749, 30568225, 7539865, 9772281		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	7539865		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12883672, 15327888, 15678502, 16870139		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15252854		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15274358, 16869958, 20085644, 20200161, 22639908, 23877345, 23922103, 24066029, 25087088, 25990623, 26337460, 26887047, 27105539, 27300295, 28440432, 28510291, 30083962, 30551391, 32183146	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	30143691	Associate	★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39766355	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	27584154	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22493396, 28654634		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	11042681, 12550762, 12646256, 12907635, 15579033, 19402075, 20059341, 29291022, 30909397		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10022739, 10417759, 10535327, 10698493, 12076276, 12378530, 12550762, 12646256, 12647800, 14713848, 15448018, 15930277, 16914575, 19402075, 20059341, 21228928, 23219378, 23867513, 23895657, 24000165, 24658158, 24767687, 25186085, 26364599, 26951228, 27453294, 27894094, 28417541, 28427859, 29291022, 29890660, 30017898, 30372389, 30478013, 30999623, 31184937, 31554440, 31582532, 8682590, 9258068		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15579033, 18636147		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	BEFREE	12750986		★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	12750986		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	15537870		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	8317502	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	30030888, 30291212, 33245030	Associate	★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	23094709		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	24150225		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	24150225	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	17243166, 19620785, 23328666, 26445453, 26674534, 29445192, 8622890		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	LHGDN	17243166, 18593989		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	21575221, 26445453, 29445192	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	21575221	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11508578, 30177313		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	34431253	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	31502214	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10359528, 10867643, 19472090, 25844809, 26295973, 26674534, 28829837, 28950372, 31380285, 8863670		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	10702398, 16258259, 20512480, 27642091, 28510278, 28829837, 8863670	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	18451162		★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	19146682, 22605650, 29216400, 32127467, 35628499	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	28950372	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25119929	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	11487273	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	28510278		★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	25401301		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15824744, 20080979, 27315458, 28117656, 28809400		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	20080979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	20080979, 33986383	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	22890162		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21520010, 27584154	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	21729677, 24500024, 24839940, 26553611, 27421137, 28374784, 30846365		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	30159127, 30646583		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	30646583	Stimulate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	24766640		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	22605616, 28590585	Associate	★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	CTD_human_DG	18391768		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	27330189		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	30879923		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	19402129		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	11839685, 12611639, 17322284		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	14559814, 17322284, 18672314, 20338593, 21847116, 22973954, 24284055, 24628993, 24827412, 24939008, 25416047, 28786540, 28903317, 30290647		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	19139719, 21043826, 21731696, 21847116, 24327519, 24827412, 40649874	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	16258259		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	18753943		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11748586, 19723643, 20107422, 20852387, 21687954, 21899661, 22052229, 22198430, 22948846, 23490239, 25348954, 25492085, 27080983, 27330186, 27330189, 27573718, 27636117, 28098570, 28460468, 30631034, 31106127, 9065649		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15254691, 17981731		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	22948846		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	11705871, 23426935, 25884729, 30885149, 31781483		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15154624, 16612144, 19639388, 21899661, 22869872, 23213056, 23226095, 23371912, 24465403, 24722284, 25234657, 26319934, 26572163, 27244893, 27329726, 27451021, 27793210, 29360662, 29792310, 30488488, 31391294, 31940827, 33655604, 36053327, 36184713, 37452322	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	25522678, 28377632, 29862232, 30279110		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	24465403		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10861506, 15623595, 19318576, 19639388, 23226095, 26832731, 27169691, 27244893, 27442811, 29231907, 29792310, 30552828, 30694565, 31391294, 31744898		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CGI_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10760755, 11966534, 12086891, 12620387, 1333188, 14719064, 18395971, 2052572, 21393565, 21424128, 22042954, 22644302, 22729845, 23327903, 23807774, 23812675, 24118504, 24223894, 24416238, 24518603, 24837198, 25203738, 25364819, 25584489, 25653235, 25881479, 25882375, 25927670, 26033401, 26049023, 26125303, 26136075, 26141986, 26238271, 26404902, 26528757, 26690587, 27185371, 27197184, 27401892, 27437872, 28052014, 28314274, 28836864, 28881678, 28968267, 29435059, 29435981, 29510730, 29630524, 29790169, 30158543, 30455128, 30466782, 30511201, 30980196, 31395059, 31499745, 31799656, 7664243		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	24742823, 33847874	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12086891, 15556605, 16461907, 16609989, 18395971, 20658094, 20713453, 21097718, 21393565, 21730976, 21777278, 22238368, 22262855, 22383989, 22389872, 22606006, 22640970, 22644302, 22751462, 23327903, 23372746, 23400546, 23807774, 23812675, 24393368, 24804300, 24837198, 25203738, 25364819, 25558650, 25592281, 25743022, 25874496, 25882375, 25945841, 26033401, 26260789, 26334097, 26587992, 27331626, 27384994, 27437872, 27765925, 28012218, 28052014, 28182330, 28343375, 28460431, 29071414, 29630524, 29781036, 30118648, 30871613, 31233202, 31395059, 31454863, 31557260, 31799656, 31905926, 32193747, 32679742, 32788873, 33374770, 33384550, 33693450, 34376535, 34516491, 34830011, 34873204, 35076580, 35650563, 35659682, 35710379, 36308181, 37945598, 37974386, 8440743, 9459603	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14719064		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	15026993, 21500189, 25874496, 26690587, 27185371, 29790169, 31395059		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16244541	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	22042947, 22729845		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28272703		★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	11223164		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	10685632, 27779808, 28511645, 28634201		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	12233882		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22890162		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	18381964		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	37041472	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	11752453, 14508824, 17914110, 20736296, 21220347, 21537871, 24810336, 25803323, 25868389, 29426928, 34565758, 35389070, 40338900	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	39510033	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	1334253, 15767811, 24170771, 26044563, 26937629, 28757314, 30463570		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	10360640, 28489587	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	30361909	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12538453		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	1334253, 24170771, 28757314, 30463570		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	22135723, 26044563, 26937629, 28013235, 28757314, 32737449, 32812852, 34791326, 38275291, 39684934	Associate	★☆☆☆☆ Found in Text Mining only
Tibia, Bowing of, with Pseudarthrosis and Pectus Excavatum	Osteofibrous Dysplasia	ORPHANET_DG	1270474, 26637977, 8276381, 9234973		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22788954, 25955731, 26123926, 27286449, 27655711, 28371195, 29843069, 29920512, 30004628, 30386383, 34863149, 37377890	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24970481, 27108696, 27116183, 27655711, 27789775, 29578538, 29978911, 30004628, 30144023, 30227653, 30289981, 30949414, 31213837		★☆☆☆☆ Found in Text Mining only
Truncus Arteriosus, Persistent	Persistent truncus arteriosus	BEFREE	24853099		★☆☆☆☆ Found in Text Mining only
Type 1 Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	UNIPROT_DG	10327054, 10417759, 10433944, 9140397, 9563489		★☆☆☆☆ Found in Text Mining only
Type 1 Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	19402075, 29149761		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10959552, 18938767		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	20661229		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	15520843		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	25178641	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17465217, 20421991, 23820886, 25405368, 26225770, 26844702, 28837140, 30469509, 31180621, 36451132, 38132404	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	18221954		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23927384, 27049264, 32094378, 32899940, 32975231	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22419847, 24551032, 25961751, 28138035, 29045509, 30008023, 31558480, 37955612, 9546344	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	25124714, 30008023, 30211813, 31558480		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	21920521	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	25516436		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	15156160, 27936052	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	12378530		★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 2	Von willebrand disorder	Pubtator	1912563	Associate	★☆☆☆☆ Found in Text Mining only
Waardenburg Syndrome	Waardenburg syndrome	Pubtator	10536986	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	1776845, 22672415		★☆☆☆☆ Found in Text Mining only
Zollinger-Ellison syndrome	Zollinger-Ellison syndrome	BEFREE	12114431		★☆☆☆☆ Found in Text Mining only