VASH2 (vasohibin 2)

Gene

• Entrez ID: 79805
• Gene name: Vasohibin 2
• Gene symbol: VASH2
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q32.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024439	hsa-miR-215-5p	Microarray	19074876
MIRT026913	hsa-miR-192-5p	Microarray	19074876
MIRT031071	hsa-miR-21-5p	Microarray	19253296
MIRT031071	hsa-miR-21-5p	Microarray	19342589
MIRT646158	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646157	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT646156	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT646155	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT646154	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT646158	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT646157	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT646156	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT646155	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT646154	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT1482819	hsa-miR-3150b-3p	CLIP-seq
MIRT1482820	hsa-miR-3160-5p	CLIP-seq
MIRT1482821	hsa-miR-339-5p	CLIP-seq
MIRT1482822	hsa-miR-361-3p	CLIP-seq
MIRT1482823	hsa-miR-4446-5p	CLIP-seq
MIRT1482824	hsa-miR-4708-5p	CLIP-seq
MIRT1482825	hsa-miR-4755-5p	CLIP-seq
MIRT1482826	hsa-miR-4784	CLIP-seq
MIRT1482827	hsa-miR-670	CLIP-seq
MIRT1482828	hsa-miR-1257	CLIP-seq
MIRT1482829	hsa-miR-3126-5p	CLIP-seq
MIRT1482830	hsa-miR-3156-5p	CLIP-seq
MIRT1482831	hsa-miR-3163	CLIP-seq
MIRT1482832	hsa-miR-4276	CLIP-seq
MIRT1482833	hsa-miR-4419a	CLIP-seq
MIRT1482834	hsa-miR-4510	CLIP-seq
MIRT1482835	hsa-miR-4658	CLIP-seq
MIRT1482836	hsa-miR-4668-3p	CLIP-seq
MIRT1482837	hsa-miR-4758-5p	CLIP-seq
MIRT1482838	hsa-miR-4765	CLIP-seq
MIRT1482839	hsa-miR-500a	CLIP-seq
MIRT1482840	hsa-miR-526b	CLIP-seq
MIRT1482841	hsa-miR-1276	CLIP-seq
MIRT1482842	hsa-miR-4311	CLIP-seq
MIRT1482843	hsa-miR-4775	CLIP-seq
MIRT1482844	hsa-miR-548g	CLIP-seq
MIRT1482845	hsa-miR-583	CLIP-seq
MIRT1482846	hsa-miR-590-3p	CLIP-seq
MIRT2145341	hsa-miR-1256	CLIP-seq
MIRT2145342	hsa-miR-1298	CLIP-seq
MIRT2145343	hsa-miR-300	CLIP-seq
MIRT2145344	hsa-miR-3140-5p	CLIP-seq
MIRT2145345	hsa-miR-3145-5p	CLIP-seq
MIRT2145346	hsa-miR-3647-3p	CLIP-seq
MIRT2145347	hsa-miR-381	CLIP-seq
MIRT2145348	hsa-miR-4642	CLIP-seq
MIRT2145349	hsa-miR-4680-3p	CLIP-seq
MIRT2145350	hsa-miR-4699-3p	CLIP-seq
MIRT2145351	hsa-miR-4729	CLIP-seq
MIRT2145352	hsa-miR-4764-3p	CLIP-seq
MIRT2145353	hsa-miR-4778-5p	CLIP-seq
MIRT2145354	hsa-miR-522	CLIP-seq
MIRT2145355	hsa-miR-579	CLIP-seq
MIRT2145356	hsa-miR-606	CLIP-seq
MIRT2145357	hsa-miR-607	CLIP-seq
MIRT2145358	hsa-miR-664	CLIP-seq
MIRT2365578	hsa-miR-137	CLIP-seq
MIRT2365579	hsa-miR-200b	CLIP-seq
MIRT2365580	hsa-miR-200c	CLIP-seq
MIRT2365581	hsa-miR-3168	CLIP-seq
MIRT2365582	hsa-miR-409-3p	CLIP-seq
MIRT2365583	hsa-miR-429	CLIP-seq
MIRT2365584	hsa-miR-4676-5p	CLIP-seq
MIRT2365585	hsa-miR-575	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000768	Process	Syncytium formation by plasma membrane fusion	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	19204325
GO:0003779	Function	Actin binding	IDA	29146869
GO:0003779	Function	Actin binding	IEA
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IDA	29146869
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IMP	31171830, 31235911
GO:0005515	Function	Protein binding	IPI	29146869, 31235911
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19204325
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006508	Process	Proteolysis	IDA	29146869
GO:0006508	Process	Proteolysis	IEA
GO:0008017	Function	Microtubule binding	IDA	31324789
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0045765	Process	Regulation of angiogenesis	IBA
GO:0045765	Process	Regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	19204325
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0060674	Process	Placenta blood vessel development	IEA
GO:0060711	Process	Labyrinthine layer development	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061564	Process	Axon development	IMP	31324789
GO:0106423	Function	Tubulin-tyrosine carboxypeptidase	IEA
GO:0140253	Process	Cell-cell fusion	IDA	25184477
GO:0140253	Process	Cell-cell fusion	IMP	25184477

Other IDs

• MIM: 610471
• HGNC: 25723
• e!Ensembl: ENSG00000143494

Protein

• UniProt ID: Q86V25
• Protein name: Tubulinyl-Tyr carboxypeptidase 2 (EC 3.4.17.17) (Vasohibin-2) (Vasohibin-like protein)
• Protein function: Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed:29146869). Critical for spindle function and accurate chromosome segregation during mitosis sin
• PDB: 6J4O, 6J4P, 6J4Q, 6J4S, 6J4V, 6QBY, 7ZCW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14822	Vasohibin	47 → 291	Vasohibin	Domain

• Sequence:

  MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDS
  HTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKT
  LQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPI
  SFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYL
  HTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASA
  HSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI

• Sequence length: 355

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVIX CARCINOMA IN SITU	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31074083		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	35922907	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35922907	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24920244, 27702660, 27867016, 29039601		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37430466	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24118388		★☆☆☆☆ Found in Text Mining only
Color Vision Defects	Color vision deficiency	Pubtator	23548203	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29641565		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29641565		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29641565		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29042694	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	28960674		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	29042694	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	32372565	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22614011		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22614011		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24920244, 27702660, 27867016, 29039601		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23615928		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24118388		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28327155, 30318866, 31074083		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28960674		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22438034, 22826464, 24920244, 26177649, 27879017, 28064471, 28327155, 30318866		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	37821528	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22826464, 24118388, 24920244, 28032401, 28064471, 29039601, 31074083		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30940294		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	22826464		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24118388		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28064471, 33710778	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28327155, 30318866, 31074083		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31074083		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30318866	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	35922907	Associate	★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28882646		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26748901		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26748901		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	23548203	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30250596		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28960674		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	28960674		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28670379		★☆☆☆☆ Found in Text Mining only