Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79763
Gene name	Isochorismatase domain containing 2
Gene symbol	ISOC2
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.42

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030140	hsa-miR-26b-5p	Microarray	19088304
MIRT052263	hsa-let-7b-5p	CLASH	23622248
MIRT043676	hsa-miR-342-3p	CLASH	23622248
MIRT041590	hsa-miR-193b-3p	CLASH	23622248
MIRT041590	hsa-miR-193b-3p	CLASH	23622248
MIRT039080	hsa-miR-769-3p	CLASH	23622248
MIRT1072940	hsa-miR-1913	CLIP-seq
MIRT1072941	hsa-miR-3165	CLIP-seq
MIRT1072942	hsa-miR-3180	CLIP-seq
MIRT1072943	hsa-miR-3180-3p	CLIP-seq
MIRT1072944	hsa-miR-3196	CLIP-seq
MIRT1072945	hsa-miR-324-3p	CLIP-seq
MIRT1072946	hsa-miR-4313	CLIP-seq
MIRT1072947	hsa-miR-4456	CLIP-seq
MIRT1072948	hsa-miR-4457	CLIP-seq
MIRT1072949	hsa-miR-4488	CLIP-seq
MIRT1072950	hsa-miR-450b-3p	CLIP-seq
MIRT1072951	hsa-miR-4685-5p	CLIP-seq
MIRT1072952	hsa-miR-4697-5p	CLIP-seq
MIRT1072953	hsa-miR-4713-3p	CLIP-seq
MIRT1072954	hsa-miR-483-3p	CLIP-seq
MIRT1072955	hsa-miR-635	CLIP-seq
MIRT1072956	hsa-miR-638	CLIP-seq
MIRT1072957	hsa-miR-1180	CLIP-seq
MIRT1072958	hsa-miR-1225-3p	CLIP-seq
MIRT1072959	hsa-miR-1281	CLIP-seq
MIRT1072960	hsa-miR-33a	CLIP-seq
MIRT1072961	hsa-miR-33b	CLIP-seq
MIRT1072962	hsa-miR-4497	CLIP-seq
MIRT1072963	hsa-miR-4532	CLIP-seq
MIRT1072964	hsa-miR-4664-3p	CLIP-seq
MIRT1072965	hsa-miR-4747-5p	CLIP-seq
MIRT1072966	hsa-miR-615-3p	CLIP-seq
MIRT1072967	hsa-miR-646	CLIP-seq
MIRT1072957	hsa-miR-1180	CLIP-seq
MIRT1072960	hsa-miR-33a	CLIP-seq
MIRT1072961	hsa-miR-33b	CLIP-seq
MIRT1072962	hsa-miR-4497	CLIP-seq
MIRT1072964	hsa-miR-4664-3p	CLIP-seq
MIRT1072968	hsa-miR-579	CLIP-seq
MIRT1072967	hsa-miR-646	CLIP-seq
MIRT1072942	hsa-miR-3180	CLIP-seq
MIRT1072943	hsa-miR-3180-3p	CLIP-seq
MIRT1072944	hsa-miR-3196	CLIP-seq
MIRT1072949	hsa-miR-4488	CLIP-seq
MIRT1072952	hsa-miR-4697-5p	CLIP-seq
MIRT2249719	hsa-miR-1224-3p	CLIP-seq
MIRT2249720	hsa-miR-1260	CLIP-seq
MIRT2249721	hsa-miR-1260b	CLIP-seq
MIRT2249722	hsa-miR-1280	CLIP-seq
MIRT2249723	hsa-miR-188-3p	CLIP-seq
MIRT2249724	hsa-miR-24	CLIP-seq
MIRT2249725	hsa-miR-3130-5p	CLIP-seq
MIRT2249726	hsa-miR-3156-3p	CLIP-seq
MIRT2249727	hsa-miR-3157-5p	CLIP-seq
MIRT2249728	hsa-miR-3180-5p	CLIP-seq
MIRT1072960	hsa-miR-33a	CLIP-seq
MIRT1072961	hsa-miR-33b	CLIP-seq
MIRT2249729	hsa-miR-4284	CLIP-seq
MIRT2249730	hsa-miR-4294	CLIP-seq
MIRT2249731	hsa-miR-4433	CLIP-seq
MIRT2249732	hsa-miR-4482	CLIP-seq
MIRT2249733	hsa-miR-4691-3p	CLIP-seq
MIRT1072968	hsa-miR-579	CLIP-seq
MIRT2249734	hsa-miR-665	CLIP-seq
MIRT2451972	hsa-miR-3127-3p	CLIP-seq
MIRT2451973	hsa-miR-4258	CLIP-seq
MIRT2451972	hsa-miR-3127-3p	CLIP-seq
MIRT2451973	hsa-miR-4258	CLIP-seq
MIRT2451972	hsa-miR-3127-3p	CLIP-seq
MIRT2451973	hsa-miR-4258	CLIP-seq
MIRT2451972	hsa-miR-3127-3p	CLIP-seq
MIRT2451973	hsa-miR-4258	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17658461
GO:0005634	Component	Nucleus	IDA	17658461
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17658461
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0031648	Process	Protein destabilization	IMP	17658461

MIM	HGNC	e!Ensembl
612928	26278	ENSG00000063241

Q96AB3

Protein name

Isochorismatase domain-containing protein 2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00857	Isochorismatase	16 → 163	Isochorismatase family	Family

Sequence

MAAARPSLGRVLPGSSVLFLCDMQEKFRHNIAYFPQIVSVAARMLKVARLLEVPVMLTEQ
YPQGLGPTVPELGTEGLRPLAKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTL
DLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEI
QKLIKEPAPDSGLLGLFQGQNSLLH

Sequence length

205

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Degenerative polyarthritis	Arthritis	CTD_human_DG	18784066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	18784066	★★★★★ ★☆☆☆☆ Found in Text Mining only

ISOC2 (isochorismatase domain containing 2)