Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79750
Gene name	Zinc finger protein 385D
Gene symbol	ZNF385D
Synonyms (NCBI Gene)	ZNF659
Chromosome	3
Chromosome location	3p24.3

Show/Hide all (60)

miRTarBase ID	miRNA	Experiments	Reference
MIRT714750	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT714749	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT648955	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT714748	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT714747	hsa-miR-623	HITS-CLIP	19536157
MIRT714746	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT714745	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT714744	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT714743	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT648955	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT714750	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	19536157
MIRT714749	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT648955	hsa-miR-627-3p	HITS-CLIP	19536157
MIRT714748	hsa-miR-2355-5p	HITS-CLIP	19536157
MIRT714747	hsa-miR-623	HITS-CLIP	19536157
MIRT714746	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT714745	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	19536157
MIRT714744	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT714743	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT648956	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT648957	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT648955	hsa-miR-627-3p	HITS-CLIP	23824327
MIRT648954	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT648953	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT648952	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT648951	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1523650	hsa-miR-1224-3p	CLIP-seq
MIRT1523651	hsa-miR-1260	CLIP-seq
MIRT1523652	hsa-miR-1260b	CLIP-seq
MIRT1523653	hsa-miR-1280	CLIP-seq
MIRT1523654	hsa-miR-1470	CLIP-seq
MIRT1523655	hsa-miR-4469	CLIP-seq
MIRT1523656	hsa-miR-4667-3p	CLIP-seq
MIRT1523657	hsa-miR-532-3p	CLIP-seq
MIRT1523650	hsa-miR-1224-3p	CLIP-seq
MIRT1523651	hsa-miR-1260	CLIP-seq
MIRT1523652	hsa-miR-1260b	CLIP-seq
MIRT1523653	hsa-miR-1280	CLIP-seq
MIRT1523654	hsa-miR-1470	CLIP-seq
MIRT1523655	hsa-miR-4469	CLIP-seq
MIRT1523656	hsa-miR-4667-3p	CLIP-seq
MIRT1523657	hsa-miR-532-3p	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
621200	26191	ENSG00000151789

Q9H6B1

Protein name

Zinc finger protein 385D (Zinc finger protein 659)

Family and domains

Pfam

Accession	ID	Position in sequence	Type
PF12874	zf-met	80 → 104	Domain
PF12874	zf-met	204 → 228	Domain
PF12874	zf-met	267 → 291	Domain

Sequence

MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAMDPIQ
KAVINHTFGVPLPHRRKQIISCNICQLRFNSDSQAAAHYKGTKHAKKLKALEAMKNKQKS
VTAKDSAKTTFTSITTNTINTSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKS
PTTATGNSSCPSTETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGT
IKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSETQLKQHISSRRHKDRAAGKPP
KPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVAVSSPFSLRTA
PAATLFQTSALPPALLRPAPGPIRTAHTPVLFAPY

Sequence length

395

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS LEISHMANIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLBLADDER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOYAMOYA DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARTIAL EPILEPSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT RESISTANT DEPRESSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar disorder	Pubtator	24387768	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31322274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	24024963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	24024963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	24024963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31322274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	31095341		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF385D (zinc finger protein 385D)