E2F8 (E2F transcription factor 8)

Gene

• Entrez ID: 79733
• Gene name: E2F transcription factor 8
• Gene symbol: E2F8
• Synonyms (NCBI Gene): E2F-8
• Chromosome: 11
• Chromosome location: 11p15.1
• Summary: This gene encodes a member of a family of transcription factors which regulate the expression of genes required for progression through the cell cycle. The encoded protein regulates progression from G1 to S phase by ensuring the nucleus divides at the pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT024943	hsa-miR-215-5p	Microarray	19074876
MIRT026752	hsa-miR-192-5p	Microarray	19074876
MIRT031294	hsa-miR-19b-3p	Sequencing	20371350
MIRT038639	hsa-miR-125a-3p	CLASH	23622248
MIRT507476	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT511989	hsa-miR-570-3p	HITS-CLIP	21572407
MIRT507480	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT507478	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT507477	hsa-miR-3924	HITS-CLIP	21572407
MIRT507475	hsa-miR-4528	HITS-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT507480	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT507477	hsa-miR-3924	PAR-CLIP	20371350
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT507475	hsa-miR-4528	PAR-CLIP	20371350
MIRT507474	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT507480	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT507477	hsa-miR-3924	PAR-CLIP	20371350
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT507475	hsa-miR-4528	PAR-CLIP	20371350
MIRT507474	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523948	hsa-miR-300	PAR-CLIP	21572407
MIRT523947	hsa-miR-381-3p	PAR-CLIP	21572407
MIRT523946	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523945	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT511989	hsa-miR-570-3p	PAR-CLIP	21572407
MIRT507480	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523944	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT523943	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT523942	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT523941	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT523940	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT523939	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT523938	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT523937	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT507477	hsa-miR-3924	PAR-CLIP	21572407
MIRT507475	hsa-miR-4528	PAR-CLIP	21572407
MIRT507474	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT031294	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT548507	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT548505	hsa-miR-4475	PAR-CLIP	21572407
MIRT548506	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT548504	hsa-miR-4698	PAR-CLIP	21572407
MIRT548503	hsa-miR-1250-3p	PAR-CLIP	21572407
MIRT548502	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT548501	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT548500	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT548499	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT548498	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT548497	hsa-miR-6716-5p	PAR-CLIP	21572407
MIRT548496	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT548495	hsa-miR-1258	PAR-CLIP	21572407
MIRT548494	hsa-miR-6892-5p	PAR-CLIP	21572407
MIRT548493	hsa-miR-4423-3p	PAR-CLIP	21572407
MIRT548492	hsa-miR-6844	PAR-CLIP	21572407
MIRT548491	hsa-miR-548aw	PAR-CLIP	21572407
MIRT548490	hsa-miR-4477b	PAR-CLIP	21572407
MIRT548489	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT548488	hsa-miR-2113	PAR-CLIP	21572407
MIRT031294	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT548507	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT548505	hsa-miR-4475	PAR-CLIP	21572407
MIRT548506	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT548504	hsa-miR-4698	PAR-CLIP	21572407
MIRT548503	hsa-miR-1250-3p	PAR-CLIP	21572407
MIRT548502	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT548501	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT548500	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT548499	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT548498	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT548497	hsa-miR-6716-5p	PAR-CLIP	21572407
MIRT548496	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT548495	hsa-miR-1258	PAR-CLIP	21572407
MIRT548494	hsa-miR-6892-5p	PAR-CLIP	21572407
MIRT548493	hsa-miR-4423-3p	PAR-CLIP	21572407
MIRT548492	hsa-miR-6844	PAR-CLIP	21572407
MIRT548491	hsa-miR-548aw	PAR-CLIP	21572407
MIRT548490	hsa-miR-4477b	PAR-CLIP	21572407
MIRT548489	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT548488	hsa-miR-2113	PAR-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT507480	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT507477	hsa-miR-3924	PAR-CLIP	21572407
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT507475	hsa-miR-4528	PAR-CLIP	21572407
MIRT507474	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523948	hsa-miR-300	PAR-CLIP	23446348
MIRT523947	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT523946	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523945	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511989	hsa-miR-570-3p	PAR-CLIP	23446348
MIRT507480	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT523944	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT523943	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT523942	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT523941	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT523940	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT523939	hsa-let-7f-2-3p	PAR-CLIP	23446348
MIRT523938	hsa-miR-1185-1-3p	PAR-CLIP	23446348
MIRT523937	hsa-miR-1185-2-3p	PAR-CLIP	23446348
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT507477	hsa-miR-3924	PAR-CLIP	23446348
MIRT507475	hsa-miR-4528	PAR-CLIP	23446348
MIRT507474	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511989	hsa-miR-570-3p	PAR-CLIP	23446348
MIRT507480	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT507477	hsa-miR-3924	PAR-CLIP	23446348
MIRT507475	hsa-miR-4528	PAR-CLIP	23446348
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT507480	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT507477	hsa-miR-3924	PAR-CLIP	23446348
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT507475	hsa-miR-4528	PAR-CLIP	23446348
MIRT507474	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT548507	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT031294	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT507476	hsa-miR-1277-5p	HITS-CLIP	27418678
MIRT507480	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT523945	hsa-miR-511-3p	HITS-CLIP	27418678
MIRT507474	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT507479	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT507476	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT511989	hsa-miR-570-3p	HITS-CLIP	21572407
MIRT507480	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT507478	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT507477	hsa-miR-3924	HITS-CLIP	21572407
MIRT507475	hsa-miR-4528	HITS-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT507480	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT507477	hsa-miR-3924	PAR-CLIP	20371350
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT507475	hsa-miR-4528	PAR-CLIP	20371350
MIRT507474	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT507480	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT507477	hsa-miR-3924	PAR-CLIP	20371350
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT507475	hsa-miR-4528	PAR-CLIP	20371350
MIRT507474	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT523948	hsa-miR-300	PAR-CLIP	21572407
MIRT523947	hsa-miR-381-3p	PAR-CLIP	21572407
MIRT523946	hsa-miR-4666a-3p	PAR-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT523945	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT511989	hsa-miR-570-3p	PAR-CLIP	21572407
MIRT507480	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT523944	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT523943	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT523942	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT523941	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT523940	hsa-miR-4789-5p	PAR-CLIP	21572407
MIRT523939	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT523938	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT523937	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT507477	hsa-miR-3924	PAR-CLIP	21572407
MIRT507475	hsa-miR-4528	PAR-CLIP	21572407
MIRT507474	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT031294	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT548507	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT548505	hsa-miR-4475	PAR-CLIP	21572407
MIRT548506	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT548504	hsa-miR-4698	PAR-CLIP	21572407
MIRT548503	hsa-miR-1250-3p	PAR-CLIP	21572407
MIRT548502	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT548501	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT548500	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT548499	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT548498	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT548497	hsa-miR-6716-5p	PAR-CLIP	21572407
MIRT548496	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT548495	hsa-miR-1258	PAR-CLIP	21572407
MIRT548494	hsa-miR-6892-5p	PAR-CLIP	21572407
MIRT548493	hsa-miR-4423-3p	PAR-CLIP	21572407
MIRT548492	hsa-miR-6844	PAR-CLIP	21572407
MIRT548491	hsa-miR-548aw	PAR-CLIP	21572407
MIRT548490	hsa-miR-4477b	PAR-CLIP	21572407
MIRT548489	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT548488	hsa-miR-2113	PAR-CLIP	21572407
MIRT031294	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT548507	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT548505	hsa-miR-4475	PAR-CLIP	21572407
MIRT548506	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT548504	hsa-miR-4698	PAR-CLIP	21572407
MIRT548503	hsa-miR-1250-3p	PAR-CLIP	21572407
MIRT548502	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT548501	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT548500	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT548499	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT548498	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT548497	hsa-miR-6716-5p	PAR-CLIP	21572407
MIRT548496	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT548495	hsa-miR-1258	PAR-CLIP	21572407
MIRT548494	hsa-miR-6892-5p	PAR-CLIP	21572407
MIRT548493	hsa-miR-4423-3p	PAR-CLIP	21572407
MIRT548492	hsa-miR-6844	PAR-CLIP	21572407
MIRT548491	hsa-miR-548aw	PAR-CLIP	21572407
MIRT548490	hsa-miR-4477b	PAR-CLIP	21572407
MIRT548489	hsa-miR-7856-5p	PAR-CLIP	21572407
MIRT548488	hsa-miR-2113	PAR-CLIP	21572407
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT507480	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT507477	hsa-miR-3924	PAR-CLIP	21572407
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT507475	hsa-miR-4528	PAR-CLIP	21572407
MIRT507474	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT523948	hsa-miR-300	PAR-CLIP	23446348
MIRT523947	hsa-miR-381-3p	PAR-CLIP	23446348
MIRT523946	hsa-miR-4666a-3p	PAR-CLIP	23446348
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT523945	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT511989	hsa-miR-570-3p	PAR-CLIP	23446348
MIRT507480	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT523944	hsa-let-7a-3p	PAR-CLIP	23446348
MIRT523943	hsa-let-7b-3p	PAR-CLIP	23446348
MIRT523942	hsa-let-7f-1-3p	PAR-CLIP	23446348
MIRT523941	hsa-miR-98-3p	PAR-CLIP	23446348
MIRT523940	hsa-miR-4789-5p	PAR-CLIP	23446348
MIRT523939	hsa-let-7f-2-3p	PAR-CLIP	23446348
MIRT523938	hsa-miR-1185-1-3p	PAR-CLIP	23446348
MIRT523937	hsa-miR-1185-2-3p	PAR-CLIP	23446348
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT507477	hsa-miR-3924	PAR-CLIP	23446348
MIRT507475	hsa-miR-4528	PAR-CLIP	23446348
MIRT507474	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT511989	hsa-miR-570-3p	PAR-CLIP	23446348
MIRT507480	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT507477	hsa-miR-3924	PAR-CLIP	23446348
MIRT507475	hsa-miR-4528	PAR-CLIP	23446348
MIRT507481	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT507480	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT507479	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT507478	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT507477	hsa-miR-3924	PAR-CLIP	23446348
MIRT507476	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT507475	hsa-miR-4528	PAR-CLIP	23446348
MIRT507474	hsa-miR-574-5p	PAR-CLIP	23446348
MIRT951009	hsa-miR-101	CLIP-seq
MIRT951010	hsa-miR-1185	CLIP-seq
MIRT951011	hsa-miR-1224-5p	CLIP-seq
MIRT951012	hsa-miR-1246	CLIP-seq
MIRT951013	hsa-miR-1290	CLIP-seq
MIRT951014	hsa-miR-144	CLIP-seq
MIRT951015	hsa-miR-19a	CLIP-seq
MIRT951016	hsa-miR-19b	CLIP-seq
MIRT951017	hsa-miR-3167	CLIP-seq
MIRT951018	hsa-miR-3605-5p	CLIP-seq
MIRT951019	hsa-miR-3647-3p	CLIP-seq
MIRT951020	hsa-miR-3679-3p	CLIP-seq
MIRT951021	hsa-miR-3679-5p	CLIP-seq
MIRT951022	hsa-miR-377	CLIP-seq
MIRT951023	hsa-miR-3915	CLIP-seq
MIRT951024	hsa-miR-421	CLIP-seq
MIRT951025	hsa-miR-4310	CLIP-seq
MIRT951026	hsa-miR-4445	CLIP-seq
MIRT951027	hsa-miR-4446-5p	CLIP-seq
MIRT951028	hsa-miR-4670-3p	CLIP-seq
MIRT951029	hsa-miR-4684-3p	CLIP-seq
MIRT951030	hsa-miR-4689	CLIP-seq
MIRT951031	hsa-miR-4699-3p	CLIP-seq
MIRT951032	hsa-miR-499-3p	CLIP-seq
MIRT951033	hsa-miR-499a-3p	CLIP-seq
MIRT951034	hsa-miR-582-5p	CLIP-seq
MIRT951035	hsa-miR-587	CLIP-seq
MIRT951036	hsa-miR-605	CLIP-seq
MIRT951037	hsa-miR-876-5p	CLIP-seq
MIRT951038	hsa-miR-889	CLIP-seq
MIRT951009	hsa-miR-101	CLIP-seq
MIRT951014	hsa-miR-144	CLIP-seq
MIRT1981642	hsa-miR-153	CLIP-seq
MIRT1981643	hsa-miR-374c	CLIP-seq
MIRT1981644	hsa-miR-448	CLIP-seq
MIRT951031	hsa-miR-4699-3p	CLIP-seq
MIRT951034	hsa-miR-582-5p	CLIP-seq
MIRT951036	hsa-miR-605	CLIP-seq
MIRT1981645	hsa-miR-655	CLIP-seq
MIRT1981646	hsa-miR-935	CLIP-seq
MIRT1981642	hsa-miR-153	CLIP-seq
MIRT1981643	hsa-miR-374c	CLIP-seq
MIRT1981644	hsa-miR-448	CLIP-seq
MIRT951034	hsa-miR-582-5p	CLIP-seq
MIRT2216595	hsa-miR-633	CLIP-seq
MIRT1981645	hsa-miR-655	CLIP-seq
MIRT1981646	hsa-miR-935	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16179649
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16179649
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	22903062
GO:0001217	Function	DNA-binding transcription repressor activity	IEA
GO:0001217	Function	DNA-binding transcription repressor activity	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	16179649
GO:0001890	Process	Placenta development	IEA
GO:0001890	Process	Placenta development	ISS
GO:0002040	Process	Sprouting angiogenesis	IEA
GO:0002040	Process	Sprouting angiogenesis	IMP	22903062
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	22903062
GO:0005515	Function	Protein binding	IPI	18202719, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0032466	Process	Negative regulation of cytokinesis	IEA
GO:0032466	Process	Negative regulation of cytokinesis	ISS
GO:0032877	Process	Positive regulation of DNA endoreduplication	IEA
GO:0032877	Process	Positive regulation of DNA endoreduplication	ISS
GO:0033301	Process	Cell cycle comprising mitosis without cytokinesis	IEA
GO:0033301	Process	Cell cycle comprising mitosis without cytokinesis	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0045935	Process	Positive regulation of nucleobase-containing compound metabolic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22903062
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	ISS
GO:0060718	Process	Chorionic trophoblast cell differentiation	IEA
GO:0060718	Process	Chorionic trophoblast cell differentiation	ISS
GO:0070365	Process	Hepatocyte differentiation	IEA
GO:0070365	Process	Hepatocyte differentiation	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 612047
• HGNC: 24727
• e!Ensembl: ENSG00000129173

Protein

• UniProt ID: A0AVK6
• Protein name: Transcription factor E2F8 (E2F-8)
• Protein function: Atypical E2F transcription factor that participates in various processes such as angiogenesis and polyploidization of specialized cells. Mainly acts as a transcription repressor that binds DNA independently of DP proteins and specifically recogn
• PDB: 4YO2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02319	E2F_TDP	114 → 182	E2F/DP family winged-helix DNA-binding domain	Domain
  PF02319	E2F_TDP	262 → 347	E2F/DP family winged-helix DNA-binding domain	Domain

• Sequence:

  MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKEGSQGEPWTPT
  ANLKMLISAVSPEIRNRDQKRGLFDNRSGLPEAKDCIHEHLSGDEFEKSQPSRKEKSLGL
  LCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTW
  HGRHNLNKTLGTLKSIGEENKYAEQIMMIKKKEYEQEFDFIKSYSIEDHIIKSNTGPNGH
  PDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHV
  EDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEISPNTSGSSPV
  IHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKLVKSIESDRRKINSAPSSPIK
  TNKAESSQNSAPFPSKMAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVN
  AEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGL
  SPTVCTTHSSKATGSKDSTDATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAG
  ERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPSGYLIPLTQCSSLGAESILSGKENS
  SALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKLMVSPTSVAAVPVGNSPALAS
  SHPVPIQNPSSAIVNFTLQHLGLISPNVQLSASPGSGIVPVSPRIESVNVAPENAGTQQG
  RATNYDSPVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMD
  FEGANKTSLGTLFVPQRKLEVSTEDVH

• Sequence length: 867

Pathways

Reactome:

TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Brain Neoplasms	Brain neoplasms	Pubtator	33381564	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26992224, 29844824		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31733123, 35279688, 40183319	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	31396343		★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	29453410	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29363506	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33499863	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26089541, 29254182		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30144184		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30144184	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33381564	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20068156, 23745020, 24440307, 27454291, 28607595, 30863181		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37863324	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31396343		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	31396343		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26992224, 29844824		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26089541, 29254182		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27683099		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27452520		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20068156, 28925392, 31396343		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	31396343		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21569352	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	27683099		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17341621, 26089541, 27454291, 31475738		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29615147		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	29754146		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28605876		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37635486	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28270228		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27683099		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27683099, 39473405	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37888771	Stimulate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30166342		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30532557		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36855110	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35421138	Associate	★☆☆☆☆ Found in Text Mining only