LIN28A (lin-28 RNA binding posttranscriptional regulator A)

Gene

• Entrez ID: 79727
• Gene name: Lin-28 RNA binding posttranscriptional regulator A
• Gene symbol: LIN28A
• Synonyms (NCBI Gene): CSDD1, LIN-28, LIN28, ZCCHC1, lin-28A
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRN

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	17400653
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	17400653
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	17400653
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	17400653
MIRT003845	hsa-miR-125b-5p	Reporter assay	18230348
MIRT003845	hsa-miR-125b-5p	B-globin reporter assay, Luciferase reporter assay	16495412
MIRT003845	hsa-miR-125b-5p	B-globin reporter assay, Luciferase reporter assay	16495412
MIRT004801	hsa-let-7a-5p	B-globin reporter assay, Luciferase reporter assay, Microarray	16495412
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	16227573
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	16227573
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	16227573
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	16227573
MIRT003738	hsa-miR-125a-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay	16227573
MIRT004011	hsa-let-7b-5p	Luciferase reporter assay	15131085
MIRT003845	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22366319
MIRT003845	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22366319
MIRT003845	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22366319
MIRT003845	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22366319
MIRT003845	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22366319
MIRT003845	hsa-miR-125b-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22366319
MIRT003845	hsa-miR-125b-5p	Immunoblot, Northern blot	15722555
MIRT004801	hsa-let-7a-5p	Immunoblot, Northern blot	15722555
MIRT017319	hsa-miR-335-5p	Microarray	18185580
MIRT003738	hsa-miR-125a-5p	Other	16227573
MIRT003845	hsa-miR-125b-5p	Other	16227573
MIRT022327	hsa-miR-124-3p	Microarray	18668037
MIRT029116	hsa-miR-26b-5p	Microarray	19088304
MIRT004011	hsa-let-7b-5p	Reporter assay	15131085
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22277001
MIRT003845	hsa-miR-125b-5p	Luciferase reporter assay, Western blot	22277001
MIRT054182	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	23019226
MIRT437395	hsa-let-7e-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23774216
MIRT437395	hsa-let-7e-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23774216
MIRT437878	hsa-miR-370-3p	Luciferase reporter assay	23729669
MIRT437878	hsa-miR-370-3p	Luciferase reporter assay	23729669
MIRT731576	mmu-let-7a-5p	Luciferase reporter assay	26898455
MIRT731576	mmu-let-7a-5p	Luciferase reporter assay	26898455
MIRT004801	hsa-let-7a-5p	qRT-PCR	25515921
MIRT004801	hsa-let-7a-5p	Luciferase reporter assay, Immunohistochemistry (IHC)	33446221
MIRT004011	hsa-let-7b-5p	Luciferase reporter assay, qRT-PCR	32697599
MIRT737092	hsa-let-7f-5p	Microarray, qRT-PCR	32623385
MIRT1110023	hsa-miR-101	CLIP-seq
MIRT1110024	hsa-miR-106a	CLIP-seq
MIRT1110025	hsa-miR-106b	CLIP-seq
MIRT1110026	hsa-miR-1183	CLIP-seq
MIRT1110027	hsa-miR-1197	CLIP-seq
MIRT1110028	hsa-miR-1207-5p	CLIP-seq
MIRT1110029	hsa-miR-1254	CLIP-seq
MIRT1110030	hsa-miR-1262	CLIP-seq
MIRT1110031	hsa-miR-128	CLIP-seq
MIRT1110032	hsa-miR-1283	CLIP-seq
MIRT1110033	hsa-miR-1286	CLIP-seq
MIRT1110034	hsa-miR-1323	CLIP-seq
MIRT1110035	hsa-miR-136	CLIP-seq
MIRT1110036	hsa-miR-142-5p	CLIP-seq
MIRT1110037	hsa-miR-144	CLIP-seq
MIRT1110038	hsa-miR-17	CLIP-seq
MIRT1110039	hsa-miR-20a	CLIP-seq
MIRT1110040	hsa-miR-20b	CLIP-seq
MIRT1110041	hsa-miR-302a	CLIP-seq
MIRT1110042	hsa-miR-302b	CLIP-seq
MIRT1110043	hsa-miR-302c	CLIP-seq
MIRT1110044	hsa-miR-302d	CLIP-seq
MIRT1110045	hsa-miR-302e	CLIP-seq
MIRT1110046	hsa-miR-30a	CLIP-seq
MIRT1110047	hsa-miR-30b	CLIP-seq
MIRT1110048	hsa-miR-30c	CLIP-seq
MIRT1110049	hsa-miR-30d	CLIP-seq
MIRT1110050	hsa-miR-30e	CLIP-seq
MIRT1110051	hsa-miR-3116	CLIP-seq
MIRT1110052	hsa-miR-3122	CLIP-seq
MIRT1110053	hsa-miR-3132	CLIP-seq
MIRT1110054	hsa-miR-3137	CLIP-seq
MIRT1110055	hsa-miR-3155	CLIP-seq
MIRT1110056	hsa-miR-3155b	CLIP-seq
MIRT1110057	hsa-miR-3179	CLIP-seq
MIRT1110058	hsa-miR-3180-5p	CLIP-seq
MIRT1110059	hsa-miR-3202	CLIP-seq
MIRT1110060	hsa-miR-329	CLIP-seq
MIRT1110061	hsa-miR-3614-3p	CLIP-seq
MIRT1110062	hsa-miR-3616-3p	CLIP-seq
MIRT1110063	hsa-miR-3622a-3p	CLIP-seq
MIRT1110064	hsa-miR-3622b-3p	CLIP-seq
MIRT1110065	hsa-miR-362-3p	CLIP-seq
MIRT1110066	hsa-miR-3653	CLIP-seq
MIRT1110067	hsa-miR-3658	CLIP-seq
MIRT1110068	hsa-miR-3661	CLIP-seq
MIRT1110069	hsa-miR-3671	CLIP-seq
MIRT1110070	hsa-miR-3672	CLIP-seq
MIRT1110071	hsa-miR-3690	CLIP-seq
MIRT1110072	hsa-miR-371b-5p	CLIP-seq
MIRT1110073	hsa-miR-372	CLIP-seq
MIRT1110074	hsa-miR-373	CLIP-seq
MIRT1110075	hsa-miR-378g	CLIP-seq
MIRT1110076	hsa-miR-3913-5p	CLIP-seq
MIRT1110077	hsa-miR-3934	CLIP-seq
MIRT1110078	hsa-miR-4252	CLIP-seq
MIRT1110079	hsa-miR-4254	CLIP-seq
MIRT1110080	hsa-miR-4268	CLIP-seq
MIRT1110081	hsa-miR-4271	CLIP-seq
MIRT1110082	hsa-miR-4274	CLIP-seq
MIRT1110083	hsa-miR-4286	CLIP-seq
MIRT1110084	hsa-miR-4297	CLIP-seq
MIRT1110085	hsa-miR-4433	CLIP-seq
MIRT1110086	hsa-miR-4436a	CLIP-seq
MIRT1110087	hsa-miR-4436b-3p	CLIP-seq
MIRT1110088	hsa-miR-4438	CLIP-seq
MIRT1110089	hsa-miR-4448	CLIP-seq
MIRT1110090	hsa-miR-4459	CLIP-seq
MIRT1110091	hsa-miR-4474-3p	CLIP-seq
MIRT1110092	hsa-miR-4519	CLIP-seq
MIRT1110093	hsa-miR-4524	CLIP-seq
MIRT1110094	hsa-miR-4633-3p	CLIP-seq
MIRT1110095	hsa-miR-4638-3p	CLIP-seq
MIRT1110096	hsa-miR-4650-3p	CLIP-seq
MIRT1110097	hsa-miR-4690-5p	CLIP-seq
MIRT1110098	hsa-miR-4701-3p	CLIP-seq
MIRT1110099	hsa-miR-4701-5p	CLIP-seq
MIRT1110100	hsa-miR-4725-3p	CLIP-seq
MIRT1110101	hsa-miR-4731-5p	CLIP-seq
MIRT1110102	hsa-miR-4747-5p	CLIP-seq
MIRT1110103	hsa-miR-4761-5p	CLIP-seq
MIRT1110104	hsa-miR-4763-3p	CLIP-seq
MIRT1110105	hsa-miR-4763-5p	CLIP-seq
MIRT1110106	hsa-miR-4768-3p	CLIP-seq
MIRT1110107	hsa-miR-4786-3p	CLIP-seq
MIRT1110108	hsa-miR-4793-3p	CLIP-seq
MIRT1110109	hsa-miR-4802-3p	CLIP-seq
MIRT1110110	hsa-miR-484	CLIP-seq
MIRT1110111	hsa-miR-489	CLIP-seq
MIRT1110112	hsa-miR-508-5p	CLIP-seq
MIRT1110113	hsa-miR-5095	CLIP-seq
MIRT1110114	hsa-miR-512-3p	CLIP-seq
MIRT1110115	hsa-miR-514	CLIP-seq
MIRT1110116	hsa-miR-514b-3p	CLIP-seq
MIRT1110117	hsa-miR-519d	CLIP-seq
MIRT1110118	hsa-miR-520a-3p	CLIP-seq
MIRT1110119	hsa-miR-520a-5p	CLIP-seq
MIRT1110120	hsa-miR-520b	CLIP-seq
MIRT1110121	hsa-miR-520c-3p	CLIP-seq
MIRT1110122	hsa-miR-520d-3p	CLIP-seq
MIRT1110123	hsa-miR-520d-5p	CLIP-seq
MIRT1110124	hsa-miR-520e	CLIP-seq
MIRT1110125	hsa-miR-520g	CLIP-seq
MIRT1110126	hsa-miR-520h	CLIP-seq
MIRT1110127	hsa-miR-524-5p	CLIP-seq
MIRT1110128	hsa-miR-525-5p	CLIP-seq
MIRT1110129	hsa-miR-541	CLIP-seq
MIRT1110130	hsa-miR-544b	CLIP-seq
MIRT1110131	hsa-miR-548o	CLIP-seq
MIRT1110132	hsa-miR-552	CLIP-seq
MIRT1110133	hsa-miR-558	CLIP-seq
MIRT1110134	hsa-miR-561	CLIP-seq
MIRT1110135	hsa-miR-581	CLIP-seq
MIRT1110136	hsa-miR-583	CLIP-seq
MIRT1110137	hsa-miR-588	CLIP-seq
MIRT1110138	hsa-miR-619	CLIP-seq
MIRT1110139	hsa-miR-631	CLIP-seq
MIRT1110140	hsa-miR-642b	CLIP-seq
MIRT1110141	hsa-miR-654-5p	CLIP-seq
MIRT1110142	hsa-miR-659	CLIP-seq
MIRT1110143	hsa-miR-661	CLIP-seq
MIRT1110144	hsa-miR-663b	CLIP-seq
MIRT1110145	hsa-miR-671-5p	CLIP-seq
MIRT1110146	hsa-miR-766	CLIP-seq
MIRT1110147	hsa-miR-9	CLIP-seq
MIRT1110148	hsa-miR-93	CLIP-seq
MIRT1110024	hsa-miR-106a	CLIP-seq
MIRT1110025	hsa-miR-106b	CLIP-seq
MIRT1110027	hsa-miR-1197	CLIP-seq
MIRT2030644	hsa-miR-122	CLIP-seq
MIRT1110030	hsa-miR-1262	CLIP-seq
MIRT1110031	hsa-miR-128	CLIP-seq
MIRT1110033	hsa-miR-1286	CLIP-seq
MIRT2030645	hsa-miR-145	CLIP-seq
MIRT1110038	hsa-miR-17	CLIP-seq
MIRT2030646	hsa-miR-1827	CLIP-seq
MIRT1110039	hsa-miR-20a	CLIP-seq
MIRT1110040	hsa-miR-20b	CLIP-seq
MIRT1110041	hsa-miR-302a	CLIP-seq
MIRT1110042	hsa-miR-302b	CLIP-seq
MIRT1110043	hsa-miR-302c	CLIP-seq
MIRT1110044	hsa-miR-302d	CLIP-seq
MIRT1110045	hsa-miR-302e	CLIP-seq
MIRT1110052	hsa-miR-3122	CLIP-seq
MIRT2030647	hsa-miR-3135b	CLIP-seq
MIRT2030648	hsa-miR-3154	CLIP-seq
MIRT1110055	hsa-miR-3155	CLIP-seq
MIRT1110056	hsa-miR-3155b	CLIP-seq
MIRT2030649	hsa-miR-34b	CLIP-seq
MIRT1110061	hsa-miR-3614-3p	CLIP-seq
MIRT2030650	hsa-miR-3614-5p	CLIP-seq
MIRT2030651	hsa-miR-3615	CLIP-seq
MIRT2030652	hsa-miR-3652	CLIP-seq
MIRT2030653	hsa-miR-3664-3p	CLIP-seq
MIRT1110070	hsa-miR-3672	CLIP-seq
MIRT2030654	hsa-miR-3688-5p	CLIP-seq
MIRT1110073	hsa-miR-372	CLIP-seq
MIRT1110074	hsa-miR-373	CLIP-seq
MIRT1110076	hsa-miR-3913-5p	CLIP-seq
MIRT2030655	hsa-miR-3929	CLIP-seq
MIRT1110077	hsa-miR-3934	CLIP-seq
MIRT1110084	hsa-miR-4297	CLIP-seq
MIRT2030656	hsa-miR-4419b	CLIP-seq
MIRT2030657	hsa-miR-4430	CLIP-seq
MIRT1110085	hsa-miR-4433	CLIP-seq
MIRT1110086	hsa-miR-4436a	CLIP-seq
MIRT1110087	hsa-miR-4436b-3p	CLIP-seq
MIRT1110088	hsa-miR-4438	CLIP-seq
MIRT1110090	hsa-miR-4459	CLIP-seq
MIRT2030658	hsa-miR-4466	CLIP-seq
MIRT2030659	hsa-miR-4470	CLIP-seq
MIRT2030660	hsa-miR-4478	CLIP-seq
MIRT2030661	hsa-miR-4649-3p	CLIP-seq
MIRT1110097	hsa-miR-4690-5p	CLIP-seq
MIRT2030662	hsa-miR-4695-3p	CLIP-seq
MIRT2030663	hsa-miR-4695-5p	CLIP-seq
MIRT1110098	hsa-miR-4701-3p	CLIP-seq
MIRT2030664	hsa-miR-4712-5p	CLIP-seq
MIRT2030665	hsa-miR-4722-5p	CLIP-seq
MIRT1110101	hsa-miR-4731-5p	CLIP-seq
MIRT1110106	hsa-miR-4768-3p	CLIP-seq
MIRT2030666	hsa-miR-4772-3p	CLIP-seq
MIRT1110110	hsa-miR-484	CLIP-seq
MIRT2030667	hsa-miR-485-5p	CLIP-seq
MIRT2030668	hsa-miR-498	CLIP-seq
MIRT2030669	hsa-miR-501-3p	CLIP-seq
MIRT2030670	hsa-miR-502-3p	CLIP-seq
MIRT1110112	hsa-miR-508-5p	CLIP-seq
MIRT1110113	hsa-miR-5095	CLIP-seq
MIRT2030671	hsa-miR-510	CLIP-seq
MIRT1110114	hsa-miR-512-3p	CLIP-seq
MIRT2030672	hsa-miR-512-5p	CLIP-seq
MIRT1110117	hsa-miR-519d	CLIP-seq
MIRT1110118	hsa-miR-520a-3p	CLIP-seq
MIRT1110120	hsa-miR-520b	CLIP-seq
MIRT1110121	hsa-miR-520c-3p	CLIP-seq
MIRT1110122	hsa-miR-520d-3p	CLIP-seq
MIRT1110124	hsa-miR-520e	CLIP-seq
MIRT1110125	hsa-miR-520g	CLIP-seq
MIRT1110126	hsa-miR-520h	CLIP-seq
MIRT1110132	hsa-miR-552	CLIP-seq
MIRT2030673	hsa-miR-605	CLIP-seq
MIRT1110140	hsa-miR-642b	CLIP-seq
MIRT1110143	hsa-miR-661	CLIP-seq
MIRT2030674	hsa-miR-675	CLIP-seq
MIRT1110146	hsa-miR-766	CLIP-seq
MIRT2030675	hsa-miR-767-5p	CLIP-seq
MIRT2030676	hsa-miR-770-5p	CLIP-seq
MIRT1110148	hsa-miR-93	CLIP-seq
MIRT2030677	hsa-miR-936	CLIP-seq
MIRT2030678	hsa-miR-940	CLIP-seq
MIRT1110024	hsa-miR-106a	CLIP-seq
MIRT1110025	hsa-miR-106b	CLIP-seq
MIRT2030644	hsa-miR-122	CLIP-seq
MIRT1110029	hsa-miR-1254	CLIP-seq
MIRT1110030	hsa-miR-1262	CLIP-seq
MIRT1110031	hsa-miR-128	CLIP-seq
MIRT1110038	hsa-miR-17	CLIP-seq
MIRT2261357	hsa-miR-181a	CLIP-seq
MIRT2261358	hsa-miR-181b	CLIP-seq
MIRT2261359	hsa-miR-181c	CLIP-seq
MIRT2261360	hsa-miR-181d	CLIP-seq
MIRT2030646	hsa-miR-1827	CLIP-seq
MIRT2261361	hsa-miR-1908	CLIP-seq
MIRT1110039	hsa-miR-20a	CLIP-seq
MIRT1110040	hsa-miR-20b	CLIP-seq
MIRT1110041	hsa-miR-302a	CLIP-seq
MIRT1110042	hsa-miR-302b	CLIP-seq
MIRT1110043	hsa-miR-302c	CLIP-seq
MIRT1110044	hsa-miR-302d	CLIP-seq
MIRT1110045	hsa-miR-302e	CLIP-seq
MIRT1110051	hsa-miR-3116	CLIP-seq
MIRT2261362	hsa-miR-3117-3p	CLIP-seq
MIRT1110052	hsa-miR-3122	CLIP-seq
MIRT2030647	hsa-miR-3135b	CLIP-seq
MIRT2261363	hsa-miR-3140-5p	CLIP-seq
MIRT2261364	hsa-miR-3159	CLIP-seq
MIRT2261365	hsa-miR-3169	CLIP-seq
MIRT1110058	hsa-miR-3180-5p	CLIP-seq
MIRT2261366	hsa-miR-3194-3p	CLIP-seq
MIRT2030649	hsa-miR-34b	CLIP-seq
MIRT2261367	hsa-miR-3607-3p	CLIP-seq
MIRT1110061	hsa-miR-3614-3p	CLIP-seq
MIRT2030650	hsa-miR-3614-5p	CLIP-seq
MIRT1110063	hsa-miR-3622a-3p	CLIP-seq
MIRT1110064	hsa-miR-3622b-3p	CLIP-seq
MIRT2030652	hsa-miR-3652	CLIP-seq
MIRT2261368	hsa-miR-3656	CLIP-seq
MIRT2030653	hsa-miR-3664-3p	CLIP-seq
MIRT1110070	hsa-miR-3672	CLIP-seq
MIRT2261369	hsa-miR-3686	CLIP-seq
MIRT1110071	hsa-miR-3690	CLIP-seq
MIRT1110073	hsa-miR-372	CLIP-seq
MIRT1110074	hsa-miR-373	CLIP-seq
MIRT1110075	hsa-miR-378g	CLIP-seq
MIRT1110076	hsa-miR-3913-5p	CLIP-seq
MIRT2030655	hsa-miR-3929	CLIP-seq
MIRT1110077	hsa-miR-3934	CLIP-seq
MIRT1110078	hsa-miR-4252	CLIP-seq
MIRT2261370	hsa-miR-4262	CLIP-seq
MIRT1110082	hsa-miR-4274	CLIP-seq
MIRT1110084	hsa-miR-4297	CLIP-seq
MIRT2261371	hsa-miR-431	CLIP-seq
MIRT2030656	hsa-miR-4419b	CLIP-seq
MIRT2261372	hsa-miR-4427	CLIP-seq
MIRT2030657	hsa-miR-4430	CLIP-seq
MIRT1110085	hsa-miR-4433	CLIP-seq
MIRT1110090	hsa-miR-4459	CLIP-seq
MIRT2030658	hsa-miR-4466	CLIP-seq
MIRT2030660	hsa-miR-4478	CLIP-seq
MIRT1110092	hsa-miR-4519	CLIP-seq
MIRT1110093	hsa-miR-4524	CLIP-seq
MIRT2261373	hsa-miR-4537	CLIP-seq
MIRT1110095	hsa-miR-4638-3p	CLIP-seq
MIRT2030661	hsa-miR-4649-3p	CLIP-seq
MIRT2261374	hsa-miR-4653-3p	CLIP-seq
MIRT2030662	hsa-miR-4695-3p	CLIP-seq
MIRT2030663	hsa-miR-4695-5p	CLIP-seq
MIRT1110098	hsa-miR-4701-3p	CLIP-seq
MIRT2261375	hsa-miR-4707-3p	CLIP-seq
MIRT2030665	hsa-miR-4722-5p	CLIP-seq
MIRT1110101	hsa-miR-4731-5p	CLIP-seq
MIRT2261376	hsa-miR-4735-5p	CLIP-seq
MIRT1110102	hsa-miR-4747-5p	CLIP-seq
MIRT2261377	hsa-miR-4759	CLIP-seq
MIRT1110103	hsa-miR-4761-5p	CLIP-seq
MIRT1110106	hsa-miR-4768-3p	CLIP-seq
MIRT2030666	hsa-miR-4772-3p	CLIP-seq
MIRT2261378	hsa-miR-4775	CLIP-seq
MIRT1110107	hsa-miR-4786-3p	CLIP-seq
MIRT1110108	hsa-miR-4793-3p	CLIP-seq
MIRT1110109	hsa-miR-4802-3p	CLIP-seq
MIRT2030667	hsa-miR-485-5p	CLIP-seq
MIRT1110112	hsa-miR-508-5p	CLIP-seq
MIRT1110113	hsa-miR-5095	CLIP-seq
MIRT2030671	hsa-miR-510	CLIP-seq
MIRT1110114	hsa-miR-512-3p	CLIP-seq
MIRT2030672	hsa-miR-512-5p	CLIP-seq
MIRT1110117	hsa-miR-519d	CLIP-seq
MIRT1110118	hsa-miR-520a-3p	CLIP-seq
MIRT1110119	hsa-miR-520a-5p	CLIP-seq
MIRT1110120	hsa-miR-520b	CLIP-seq
MIRT1110121	hsa-miR-520c-3p	CLIP-seq
MIRT1110122	hsa-miR-520d-3p	CLIP-seq
MIRT1110124	hsa-miR-520e	CLIP-seq
MIRT1110125	hsa-miR-520g	CLIP-seq
MIRT1110126	hsa-miR-520h	CLIP-seq
MIRT1110128	hsa-miR-525-5p	CLIP-seq
MIRT1110129	hsa-miR-541	CLIP-seq
MIRT1110130	hsa-miR-544b	CLIP-seq
MIRT2261379	hsa-miR-550a	CLIP-seq
MIRT1110132	hsa-miR-552	CLIP-seq
MIRT2261380	hsa-miR-590-3p	CLIP-seq
MIRT2261381	hsa-miR-615-5p	CLIP-seq
MIRT1110140	hsa-miR-642b	CLIP-seq
MIRT1110141	hsa-miR-654-5p	CLIP-seq
MIRT1110142	hsa-miR-659	CLIP-seq
MIRT1110143	hsa-miR-661	CLIP-seq
MIRT2261382	hsa-miR-663	CLIP-seq
MIRT1110145	hsa-miR-671-5p	CLIP-seq
MIRT2030674	hsa-miR-675	CLIP-seq
MIRT1110146	hsa-miR-766	CLIP-seq
MIRT1110147	hsa-miR-9	CLIP-seq
MIRT2261383	hsa-miR-924	CLIP-seq
MIRT1110148	hsa-miR-93	CLIP-seq
MIRT2030678	hsa-miR-940	CLIP-seq
MIRT2390154	hsa-miR-10a	CLIP-seq
MIRT2390155	hsa-miR-10b	CLIP-seq
MIRT1110029	hsa-miR-1254	CLIP-seq
MIRT1110051	hsa-miR-3116	CLIP-seq
MIRT1110052	hsa-miR-3122	CLIP-seq
MIRT1110058	hsa-miR-3180-5p	CLIP-seq
MIRT1110060	hsa-miR-329	CLIP-seq
MIRT2390156	hsa-miR-3620	CLIP-seq
MIRT1110063	hsa-miR-3622a-3p	CLIP-seq
MIRT1110064	hsa-miR-3622b-3p	CLIP-seq
MIRT1110065	hsa-miR-362-3p	CLIP-seq
MIRT2030654	hsa-miR-3688-5p	CLIP-seq
MIRT1110071	hsa-miR-3690	CLIP-seq
MIRT1110076	hsa-miR-3913-5p	CLIP-seq
MIRT1110085	hsa-miR-4433	CLIP-seq
MIRT1110090	hsa-miR-4459	CLIP-seq
MIRT1110095	hsa-miR-4638-3p	CLIP-seq
MIRT1110102	hsa-miR-4747-5p	CLIP-seq
MIRT1110103	hsa-miR-4761-5p	CLIP-seq
MIRT1110106	hsa-miR-4768-3p	CLIP-seq
MIRT1110107	hsa-miR-4786-3p	CLIP-seq
MIRT1110119	hsa-miR-520a-5p	CLIP-seq
MIRT1110123	hsa-miR-520d-5p	CLIP-seq
MIRT1110127	hsa-miR-524-5p	CLIP-seq
MIRT1110128	hsa-miR-525-5p	CLIP-seq
MIRT1110129	hsa-miR-541	CLIP-seq
MIRT1110141	hsa-miR-654-5p	CLIP-seq
MIRT1110145	hsa-miR-671-5p	CLIP-seq
MIRT1110052	hsa-miR-3122	CLIP-seq
MIRT2453057	hsa-miR-3659	CLIP-seq
MIRT1110076	hsa-miR-3913-5p	CLIP-seq
MIRT2453058	hsa-miR-4658	CLIP-seq
MIRT2453059	hsa-miR-4684-5p	CLIP-seq
MIRT1110102	hsa-miR-4747-5p	CLIP-seq
MIRT1110103	hsa-miR-4761-5p	CLIP-seq
MIRT1110107	hsa-miR-4786-3p	CLIP-seq
MIRT1110129	hsa-miR-541	CLIP-seq
MIRT2453060	hsa-miR-548c-3p	CLIP-seq
MIRT2453061	hsa-miR-574-5p	CLIP-seq
MIRT2453062	hsa-miR-644	CLIP-seq
MIRT1110141	hsa-miR-654-5p	CLIP-seq
MIRT1110145	hsa-miR-671-5p	CLIP-seq
MIRT2030644	hsa-miR-122	CLIP-seq
MIRT2561379	hsa-miR-1237	CLIP-seq
MIRT2561380	hsa-miR-1248	CLIP-seq
MIRT2561381	hsa-miR-129-5p	CLIP-seq
MIRT1110052	hsa-miR-3122	CLIP-seq
MIRT2030647	hsa-miR-3135b	CLIP-seq
MIRT2561382	hsa-miR-3149	CLIP-seq
MIRT2030651	hsa-miR-3615	CLIP-seq
MIRT1110063	hsa-miR-3622a-3p	CLIP-seq
MIRT1110064	hsa-miR-3622b-3p	CLIP-seq
MIRT2561383	hsa-miR-3622b-5p	CLIP-seq
MIRT2561384	hsa-miR-362-5p	CLIP-seq
MIRT2030652	hsa-miR-3652	CLIP-seq
MIRT1110076	hsa-miR-3913-5p	CLIP-seq
MIRT2561385	hsa-miR-411	CLIP-seq
MIRT2030657	hsa-miR-4430	CLIP-seq
MIRT2030658	hsa-miR-4466	CLIP-seq
MIRT2030662	hsa-miR-4695-3p	CLIP-seq
MIRT2261376	hsa-miR-4735-5p	CLIP-seq
MIRT1110102	hsa-miR-4747-5p	CLIP-seq
MIRT1110103	hsa-miR-4761-5p	CLIP-seq
MIRT2030666	hsa-miR-4772-3p	CLIP-seq
MIRT2261378	hsa-miR-4775	CLIP-seq
MIRT1110107	hsa-miR-4786-3p	CLIP-seq
MIRT2561386	hsa-miR-4795-3p	CLIP-seq
MIRT2030668	hsa-miR-498	CLIP-seq
MIRT2561387	hsa-miR-500b	CLIP-seq
MIRT2561388	hsa-miR-501-5p	CLIP-seq
MIRT1110129	hsa-miR-541	CLIP-seq
MIRT2261380	hsa-miR-590-3p	CLIP-seq
MIRT1110141	hsa-miR-654-5p	CLIP-seq
MIRT1110145	hsa-miR-671-5p	CLIP-seq
MIRT2030674	hsa-miR-675	CLIP-seq
MIRT2561389	hsa-miR-941	CLIP-seq
MIRT2561390	hsa-miR-944	CLIP-seq
MIRT2030644	hsa-miR-122	CLIP-seq
MIRT2561379	hsa-miR-1237	CLIP-seq
MIRT2561380	hsa-miR-1248	CLIP-seq
MIRT2561381	hsa-miR-129-5p	CLIP-seq
MIRT1110052	hsa-miR-3122	CLIP-seq
MIRT2030647	hsa-miR-3135b	CLIP-seq
MIRT2561382	hsa-miR-3149	CLIP-seq
MIRT2030651	hsa-miR-3615	CLIP-seq
MIRT2561383	hsa-miR-3622b-5p	CLIP-seq
MIRT2561384	hsa-miR-362-5p	CLIP-seq
MIRT2030652	hsa-miR-3652	CLIP-seq
MIRT1110076	hsa-miR-3913-5p	CLIP-seq
MIRT2030657	hsa-miR-4430	CLIP-seq
MIRT1110085	hsa-miR-4433	CLIP-seq
MIRT1110090	hsa-miR-4459	CLIP-seq
MIRT2030658	hsa-miR-4466	CLIP-seq
MIRT2030662	hsa-miR-4695-3p	CLIP-seq
MIRT2261376	hsa-miR-4735-5p	CLIP-seq
MIRT1110102	hsa-miR-4747-5p	CLIP-seq
MIRT1110103	hsa-miR-4761-5p	CLIP-seq
MIRT1110106	hsa-miR-4768-3p	CLIP-seq
MIRT2030666	hsa-miR-4772-3p	CLIP-seq
MIRT2261378	hsa-miR-4775	CLIP-seq
MIRT1110107	hsa-miR-4786-3p	CLIP-seq
MIRT2561386	hsa-miR-4795-3p	CLIP-seq
MIRT2561387	hsa-miR-500b	CLIP-seq
MIRT2561388	hsa-miR-501-5p	CLIP-seq
MIRT1110129	hsa-miR-541	CLIP-seq
MIRT2261380	hsa-miR-590-3p	CLIP-seq
MIRT1110141	hsa-miR-654-5p	CLIP-seq
MIRT1110145	hsa-miR-671-5p	CLIP-seq
MIRT2030674	hsa-miR-675	CLIP-seq
MIRT2561389	hsa-miR-941	CLIP-seq
MIRT2561390	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KAT2B	Unknown	24631505
REST	Repression	22532168
SIRT1	Unknown	24631505

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	17617744
GO:0000932	Component	P-body	IEA
GO:0002151	Function	G-quadruplex RNA binding	IEA
GO:0002151	Function	G-quadruplex RNA binding	ISS
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IDA	19703396
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	21247876
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	19703396, 21247876, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17617744
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18604195, 20014101, 21247876
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0005791	Component	Rough endoplasmic reticulum	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007281	Process	Germ cell development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010494	Component	Cytoplasmic stress granule	IDA	17617744
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010586	Process	MiRNA metabolic process	IEA
GO:0010587	Process	MiRNA catabolic process	IEA
GO:0010587	Process	MiRNA catabolic process	IMP	19703396
GO:0010587	Process	MiRNA catabolic process	ISS
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0017148	Process	Negative regulation of translation	ISS
GO:0019827	Process	Stem cell population maintenance	IMP	19703396
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031054	Process	Pre-miRNA processing	IBA
GO:0031054	Process	Pre-miRNA processing	IEA
GO:0031054	Process	Pre-miRNA processing	IEA
GO:0031054	Process	Pre-miRNA processing	IMP	19703396
GO:0031123	Process	RNA 3'-end processing	IEA
GO:0031123	Process	RNA 3'-end processing	IMP	19703396
GO:0031369	Function	Translation initiation factor binding	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0032008	Process	Positive regulation of TOR signaling	ISS
GO:0035198	Function	MiRNA binding	IEA
GO:0035198	Function	MiRNA binding	ISS
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045686	Process	Negative regulation of glial cell differentiation	IEA
GO:0045727	Process	Positive regulation of translation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0060964	Process	Regulation of miRNA-mediated gene silencing	IEA
GO:0070883	Function	Pre-miRNA binding	IDA	21247876
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0140517	Function	Protein-RNA adaptor activity	IDA	18951094
GO:1901724	Process	Positive regulation of cell proliferation involved in kidney development	IEA
GO:1990825	Function	Sequence-specific mRNA binding	IEA
GO:1990825	Function	Sequence-specific mRNA binding	ISS
GO:2000632	Process	Negative regulation of pre-miRNA processing	IDA	21247876
GO:2000632	Process	Negative regulation of pre-miRNA processing	IEA
GO:2000767	Process	Positive regulation of cytoplasmic translation	IMP	21247876

Other IDs

• MIM: 611043
• HGNC: 15986
• e!Ensembl: ENSG00000131914

Protein

• UniProt ID: Q9H9Z2
• Protein name: Protein lin-28 homolog A (Lin-28A) (Zinc finger CCHC domain-containing protein 1)
• Protein function: RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism (PubMed:21247876). Seems to recognize a common structural G-quartet (G4) feature i
• PDB: 2CQF, 2LI8, 5UDZ, 8OPS, 8OPT, 8OST
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00313	CSD	40 → 112		Domain
  PF00098	zf-CCHC	137 → 154	Zinc knuckle	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in embryonic stem cells, placenta and testis. Tends to be up-regulated in HER2-overexpressing breast tumors. {ECO:0000269|PubMed:14688391, ECO:0000269|PubMed:15614775, ECO:0000269|PubMed:15722555, ECO:0000269|PubMed:22118463}
• Sequence:

  MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
  RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
  ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
  GPSAQGKPTYFREEEEEIHSPTLLPEAQN

• Sequence length: 209

Pathways

Reactome:

Transcriptional regulation of pluripotent stem cells

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	28569789		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	28569789		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28569789		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30196987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	25956904		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	25200669		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	25200669		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	28744687		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	25200669		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	37559082	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	25188417		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	26944953		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	25200669		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27230676	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	23161096, 25638158, 28582547, 28744687		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	19483683		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24036903		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	22691720, 31287992	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23161096, 23846349		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21912531, 22081076, 22532168, 22808086, 24349438, 25223935, 26149387, 26898455, 27494865, 28102845, 28147339, 30799940, 31595560		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21912531, 22118463, 22808086, 23840685, 24349438, 26149387, 26460550, 28102845, 32560271, 39849871	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23161096, 25503985, 29724816, 29874593, 30531691	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26080928	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	22467868	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25200669, 30196987		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22429493, 24475120, 29742265, 33901943, 35955552	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	39849871	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24036903		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21553022, 28587210, 30256974		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23255092, 26158423, 30365085	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21982273	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	34911496	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19477633, 20101213, 24475120, 26158423, 30266988, 30365085		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31637712		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	28744687		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	28744687		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	29963023		★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	Pubtator	36395688	Associate	★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29066347		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28732738, 29226952		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24475120, 26687759, 27793004, 27859935		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24475120	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23307247, 25956904, 27859935, 29393430, 29944017, 30076414		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26687759, 27793004, 27859935, 29393430, 31510013	Associate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	31274480	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21962509, 30883865		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21962509, 30883865		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37028179	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23660113		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31637712		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25354942, 31485601		★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	25748578		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35832124	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoblastoma	Ependymoblastoma	BEFREE	23161096, 23863344, 24311633, 24470553, 25697539, 28744687		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19477633, 20101213, 30365085		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	22467868		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23674108		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23674108		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29393461	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23596304		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28536261		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	23774216		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23846349, 24356103, 24475120, 27184842, 28494471		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24475120	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23846349, 24356103, 24475120, 27184842, 28494471		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24475120		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24475120	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIA	Glycogen storage disease	Pubtator	30269021	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31574415		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30734494	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23420006		★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	32571380	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	22118463, 23840685	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32560271	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30203263		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23079661		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29874593	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	28569789	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28569789	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28569789		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20525879, 22429493, 23318446, 23728999, 24379607, 24475120, 24970027, 25378324, 27721018, 29742265, 30196987		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	23318446		★☆☆☆☆ Found in Text Mining only
LONG QT SYNDROME 3	Long QT Syndrome	BEFREE	23998552		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	22433967	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30531691	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	24839957		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31574415		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of adrenal cortex	Adrenocortical carcinoma	BEFREE	25200669		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	31287992		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21912531, 22081076, 22532168, 22808086, 24349438, 25223935, 26149387, 26898455, 27494865, 28102845, 28147339, 30799940, 31595560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22433967, 23674108		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27721018		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21553022, 28587210, 30256974		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25503985		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20101213, 24475120, 30266988		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23335963, 26910839		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22128178, 22479342, 23790802, 26714839		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25128063, 25515921, 26636340		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24036903		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19477633, 19483683, 19578360, 20005451, 21962509, 22081076, 22118463, 22429493, 22467868, 22713243, 22808086, 23500413, 24244607, 24294832, 24349438, 25269615, 25301052, 25415050, 25633261, 25638158, 25748578, 25858147, 26123544, 26149387, 26583126, 26687759, 26910839, 27012771, 27184842, 27494865, 28400788, 28745393, 28947981, 29742265, 30266988, 30531691, 30543854, 30976203, 31338973, 31574415, 31747721		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	19483683		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26687759, 27793004, 27859935		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22118463, 22532168, 22713243		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	26250335	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	28744687		★☆☆☆☆ Found in Text Mining only
Medulloepithelioma	Medulloepithelioma	BEFREE	25748578, 28744687		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30883865		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	31235756		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	31235756	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25503985	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27773931		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30734494		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19477633, 21725800, 22081076, 22118463, 22429493, 22433967, 22467868, 22532168, 22808086, 23596304, 23846349, 24294832, 24337497, 24349438, 24475120, 24732380, 24788514, 24839957, 24970027, 25128063, 25303610, 25748578, 25956904, 26687759, 28147339, 28423547, 28569789, 28971535, 29246575, 30617578, 30994507, 31379107		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	19483683		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	24732380, 25018051, 25190313, 25490692, 28301057, 29950491, 31338973		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	31064784		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25415050, 31747721		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31747721	Associate	★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	30616142		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24780874, 28235063		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24475120		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	22240064		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20101213, 23255092, 30266988		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23255092, 24475120, 26583126, 30365085	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23335963, 26910839		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26910839	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30531691		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31750563		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	38615589	Associate	★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	30046338		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	22240064		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22128178, 22479342, 23790802, 26714839		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26714839	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	25748578		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	30789962	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	25638158		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	23161096	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24386298		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	27441500		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	21553022, 31146720		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23500413, 25245141, 30394668		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29393461		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31574415		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25128063, 25515921, 26636340, 30196987		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25128063, 26893371, 29510730, 30833806, 36160641	Associate	★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	24036903		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	19376775, 26306513		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30531691	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	27464948	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	24036903		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29416635		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35102250	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33516780	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	25190313, 31338973	Associate	★☆☆☆☆ Found in Text Mining only