Gene Gene information from NCBI Gene database.
Entrez ID 79720
Gene name VPS37B subunit of ESCRT-I
Gene symbol VPS37B
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q24.31
miRNA miRNA information provided by mirtarbase database.
312
miRTarBase ID miRNA Experiments Reference
MIRT019654 hsa-miR-378a-3p Sequencing 20371350
MIRT025496 hsa-miR-34a-5p Sequencing 20371350
MIRT043537 hsa-miR-331-3p CLASH 23622248
MIRT039479 hsa-miR-652-3p CLASH 23622248
MIRT036597 hsa-miR-940 CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000813 Component ESCRT I complex IBA
GO:0000813 Component ESCRT I complex IDA 18005716, 22232651, 22405001
GO:0000813 Component ESCRT I complex IEA
GO:0000813 Component ESCRT I complex IPI 18005716, 21757351, 32424346
GO:0000813 Component ESCRT I complex TAS 20588296
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610037 25754 ENSG00000139722
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H9H4
Protein name Vacuolar protein sorting-associated protein 37B (hVps37B) (ESCRT-I complex subunit VPS37B)
Protein function Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation. {ECO:0000269|PubMed:152180
PDB 6VME
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07200 Mod_r 11 156 Modifier of rudimentary (Mod(r)) protein Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in macrophages and lymphocytes. {ECO:0000269|PubMed:15218037}.
Sequence
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
LYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKI
EKLQEMVLKGQRLPQALAPLPPRL
PELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQC
PPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ
Sequence length 285
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Endocytosis   Budding and maturation of HIV virion
Membrane binding and targetting of GAG proteins
Endosomal Sorting Complex Required For Transport (ESCRT)
HCMV Late Events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATRIAL FIBRILLATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 31377428 Associate
★☆☆☆☆
Found in Text Mining only