Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79689
Gene name	STEAP4 metalloreductase
Gene symbol	STEAP4
Synonyms (NCBI Gene)	STAMP2SchLAHTIARPTNFAIP9
Chromosome	7
Chromosome location	7q21.12
Summary	The protein encoded by this gene belongs to the STEAP (six transmembrane epithelial antigen of prostate) family, and resides in the golgi apparatus. It functions as a metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1

231

Show/Hide all (231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019488	hsa-miR-148b-3p	Microarray	17612493
MIRT048618	hsa-miR-99a-5p	CLASH	23622248
MIRT644974	hsa-miR-548ac	HITS-CLIP	23824327
MIRT644973	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT644972	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT644971	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT644970	hsa-miR-548z	HITS-CLIP	23824327
MIRT644969	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT644968	hsa-miR-3938	HITS-CLIP	23824327
MIRT644967	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT644966	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT644964	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644965	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT644963	hsa-miR-623	HITS-CLIP	23824327
MIRT644962	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT644961	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT644960	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT644959	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT644958	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT644974	hsa-miR-548ac	HITS-CLIP	23824327
MIRT644973	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT644972	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT644971	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT644970	hsa-miR-548z	HITS-CLIP	23824327
MIRT644969	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT644968	hsa-miR-3938	HITS-CLIP	23824327
MIRT644967	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT644966	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT644964	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644965	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT644963	hsa-miR-623	HITS-CLIP	23824327
MIRT644962	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT644961	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT644960	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT644959	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT644958	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT735932	hsa-miR-1265	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRIn situ hybridization	31648990
MIRT644974	hsa-miR-548ac	HITS-CLIP	23824327
MIRT644973	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT644972	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT644971	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT644970	hsa-miR-548z	HITS-CLIP	23824327
MIRT644969	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT644968	hsa-miR-3938	HITS-CLIP	23824327
MIRT644967	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT644966	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT644964	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644965	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT644963	hsa-miR-623	HITS-CLIP	23824327
MIRT644962	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT644961	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT644960	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT644959	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT644958	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT644974	hsa-miR-548ac	HITS-CLIP	23824327
MIRT644973	hsa-miR-548bb-3p	HITS-CLIP	23824327
MIRT644972	hsa-miR-548d-3p	HITS-CLIP	23824327
MIRT644971	hsa-miR-548h-3p	HITS-CLIP	23824327
MIRT644970	hsa-miR-548z	HITS-CLIP	23824327
MIRT644969	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT644968	hsa-miR-3938	HITS-CLIP	23824327
MIRT644967	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT644966	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT644964	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT644965	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT644963	hsa-miR-623	HITS-CLIP	23824327
MIRT644962	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT644961	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT644960	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT644959	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT644958	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT1396924	hsa-miR-1827	CLIP-seq
MIRT1396925	hsa-miR-3145-5p	CLIP-seq
MIRT1396926	hsa-miR-338-3p	CLIP-seq
MIRT1396927	hsa-miR-3612	CLIP-seq
MIRT1396928	hsa-miR-3614-5p	CLIP-seq
MIRT1396929	hsa-miR-3653	CLIP-seq
MIRT1396930	hsa-miR-3658	CLIP-seq
MIRT1396931	hsa-miR-4514	CLIP-seq
MIRT1396932	hsa-miR-4692	CLIP-seq
MIRT1396933	hsa-miR-4764-3p	CLIP-seq
MIRT1396934	hsa-miR-548u	CLIP-seq
MIRT1396935	hsa-miR-650	CLIP-seq
MIRT1396936	hsa-miR-656	CLIP-seq
MIRT1396937	hsa-miR-940	CLIP-seq
MIRT1396938	hsa-miR-10a	CLIP-seq
MIRT1396939	hsa-miR-10b	CLIP-seq
MIRT1396940	hsa-miR-2114	CLIP-seq
MIRT1396941	hsa-miR-3192	CLIP-seq
MIRT1396942	hsa-miR-339-5p	CLIP-seq
MIRT1396943	hsa-miR-3689a-3p	CLIP-seq
MIRT1396944	hsa-miR-3689c	CLIP-seq
MIRT1396945	hsa-miR-3929	CLIP-seq
MIRT1396946	hsa-miR-4293	CLIP-seq
MIRT1396947	hsa-miR-4419b	CLIP-seq
MIRT1396948	hsa-miR-4421	CLIP-seq
MIRT1396949	hsa-miR-4478	CLIP-seq
MIRT1396950	hsa-miR-4502	CLIP-seq
MIRT1396951	hsa-miR-451b	CLIP-seq
MIRT1396952	hsa-miR-4684-5p	CLIP-seq
MIRT1396953	hsa-miR-4696	CLIP-seq
MIRT1396954	hsa-miR-4728-5p	CLIP-seq
MIRT1396955	hsa-miR-4729	CLIP-seq
MIRT1396956	hsa-miR-4775	CLIP-seq
MIRT1396957	hsa-miR-485-5p	CLIP-seq
MIRT1396958	hsa-miR-490-3p	CLIP-seq
MIRT1396959	hsa-miR-508-5p	CLIP-seq
MIRT1396960	hsa-miR-548k	CLIP-seq
MIRT1396961	hsa-miR-548n	CLIP-seq
MIRT1396962	hsa-miR-548t	CLIP-seq
MIRT1396963	hsa-miR-579	CLIP-seq
MIRT1396964	hsa-miR-590-3p	CLIP-seq
MIRT1396965	hsa-miR-593	CLIP-seq
MIRT1396966	hsa-miR-765	CLIP-seq
MIRT1396967	hsa-miR-766	CLIP-seq
MIRT1396968	hsa-miR-1285	CLIP-seq
MIRT1396969	hsa-miR-3187-5p	CLIP-seq
MIRT1396970	hsa-miR-3677-5p	CLIP-seq
MIRT1396971	hsa-miR-3945	CLIP-seq
MIRT1396972	hsa-miR-4253	CLIP-seq
MIRT1396973	hsa-miR-612	CLIP-seq
MIRT2118855	hsa-miR-3155	CLIP-seq
MIRT2118856	hsa-miR-3155b	CLIP-seq
MIRT2118857	hsa-miR-4464	CLIP-seq
MIRT2118858	hsa-miR-450b-5p	CLIP-seq
MIRT1396953	hsa-miR-4696	CLIP-seq
MIRT2118859	hsa-miR-4748	CLIP-seq
MIRT2118860	hsa-miR-484	CLIP-seq
MIRT2118861	hsa-miR-507	CLIP-seq
MIRT2118862	hsa-miR-557	CLIP-seq
MIRT2118863	hsa-miR-583	CLIP-seq
MIRT2118864	hsa-miR-759	CLIP-seq
MIRT2341207	hsa-miR-1227	CLIP-seq
MIRT1396924	hsa-miR-1827	CLIP-seq
MIRT1396940	hsa-miR-2114	CLIP-seq
MIRT2341208	hsa-miR-3197	CLIP-seq
MIRT1396927	hsa-miR-3612	CLIP-seq
MIRT1396928	hsa-miR-3614-5p	CLIP-seq
MIRT1396945	hsa-miR-3929	CLIP-seq
MIRT2341209	hsa-miR-4252	CLIP-seq
MIRT1396947	hsa-miR-4419b	CLIP-seq
MIRT1396949	hsa-miR-4478	CLIP-seq
MIRT1396950	hsa-miR-4502	CLIP-seq
MIRT1396931	hsa-miR-4514	CLIP-seq
MIRT1396932	hsa-miR-4692	CLIP-seq
MIRT1396957	hsa-miR-485-5p	CLIP-seq
MIRT1396935	hsa-miR-650	CLIP-seq
MIRT2341210	hsa-miR-658	CLIP-seq
MIRT1396937	hsa-miR-940	CLIP-seq
MIRT2341207	hsa-miR-1227	CLIP-seq
MIRT2395344	hsa-miR-3153	CLIP-seq
MIRT1396941	hsa-miR-3192	CLIP-seq
MIRT2395345	hsa-miR-3649	CLIP-seq
MIRT1396943	hsa-miR-3689a-3p	CLIP-seq
MIRT1396944	hsa-miR-3689c	CLIP-seq
MIRT2341209	hsa-miR-4252	CLIP-seq
MIRT2395346	hsa-miR-4270	CLIP-seq
MIRT1396946	hsa-miR-4293	CLIP-seq
MIRT2395347	hsa-miR-4441	CLIP-seq
MIRT1396954	hsa-miR-4728-5p	CLIP-seq
MIRT2395348	hsa-miR-4793-3p	CLIP-seq
MIRT1396958	hsa-miR-490-3p	CLIP-seq
MIRT2395349	hsa-miR-492	CLIP-seq
MIRT1396959	hsa-miR-508-5p	CLIP-seq
MIRT1396966	hsa-miR-765	CLIP-seq
MIRT1396967	hsa-miR-766	CLIP-seq
MIRT1396938	hsa-miR-10a	CLIP-seq
MIRT1396939	hsa-miR-10b	CLIP-seq
MIRT1396968	hsa-miR-1285	CLIP-seq
MIRT1396940	hsa-miR-2114	CLIP-seq
MIRT1396969	hsa-miR-3187-5p	CLIP-seq
MIRT1396942	hsa-miR-339-5p	CLIP-seq
MIRT2460660	hsa-miR-34b	CLIP-seq
MIRT1396928	hsa-miR-3614-5p	CLIP-seq
MIRT1396945	hsa-miR-3929	CLIP-seq
MIRT1396971	hsa-miR-3945	CLIP-seq
MIRT1396972	hsa-miR-4253	CLIP-seq
MIRT1396947	hsa-miR-4419b	CLIP-seq
MIRT1396948	hsa-miR-4421	CLIP-seq
MIRT1396949	hsa-miR-4478	CLIP-seq
MIRT1396952	hsa-miR-4684-5p	CLIP-seq
MIRT1396957	hsa-miR-485-5p	CLIP-seq
MIRT1396958	hsa-miR-490-3p	CLIP-seq
MIRT1396960	hsa-miR-548k	CLIP-seq
MIRT1396961	hsa-miR-548n	CLIP-seq
MIRT1396962	hsa-miR-548t	CLIP-seq
MIRT1396965	hsa-miR-593	CLIP-seq
MIRT1396973	hsa-miR-612	CLIP-seq
MIRT1396938	hsa-miR-10a	CLIP-seq
MIRT1396939	hsa-miR-10b	CLIP-seq
MIRT1396942	hsa-miR-339-5p	CLIP-seq
MIRT1396948	hsa-miR-4421	CLIP-seq
MIRT1396952	hsa-miR-4684-5p	CLIP-seq
MIRT1396960	hsa-miR-548k	CLIP-seq
MIRT1396961	hsa-miR-548n	CLIP-seq
MIRT1396962	hsa-miR-548t	CLIP-seq
MIRT1396965	hsa-miR-593	CLIP-seq
MIRT1396938	hsa-miR-10a	CLIP-seq
MIRT1396939	hsa-miR-10b	CLIP-seq
MIRT2692208	hsa-miR-1182	CLIP-seq
MIRT2692209	hsa-miR-1183	CLIP-seq
MIRT1396968	hsa-miR-1285	CLIP-seq
MIRT1396940	hsa-miR-2114	CLIP-seq
MIRT2692210	hsa-miR-3065-3p	CLIP-seq
MIRT2395344	hsa-miR-3153	CLIP-seq
MIRT1396969	hsa-miR-3187-5p	CLIP-seq
MIRT1396941	hsa-miR-3192	CLIP-seq
MIRT2692211	hsa-miR-326	CLIP-seq
MIRT2692212	hsa-miR-330-5p	CLIP-seq
MIRT1396942	hsa-miR-339-5p	CLIP-seq
MIRT1396945	hsa-miR-3929	CLIP-seq
MIRT1396971	hsa-miR-3945	CLIP-seq
MIRT1396972	hsa-miR-4253	CLIP-seq
MIRT1396946	hsa-miR-4293	CLIP-seq
MIRT2692213	hsa-miR-4314	CLIP-seq
MIRT1396947	hsa-miR-4419b	CLIP-seq
MIRT1396948	hsa-miR-4421	CLIP-seq
MIRT1396949	hsa-miR-4478	CLIP-seq
MIRT1396950	hsa-miR-4502	CLIP-seq
MIRT2692214	hsa-miR-4522	CLIP-seq
MIRT2692215	hsa-miR-4646-5p	CLIP-seq
MIRT2692216	hsa-miR-4668-5p	CLIP-seq
MIRT1396952	hsa-miR-4684-5p	CLIP-seq
MIRT2692217	hsa-miR-4757-5p	CLIP-seq
MIRT1396957	hsa-miR-485-5p	CLIP-seq
MIRT1396960	hsa-miR-548k	CLIP-seq
MIRT1396961	hsa-miR-548n	CLIP-seq
MIRT1396962	hsa-miR-548t	CLIP-seq
MIRT1396965	hsa-miR-593	CLIP-seq
MIRT1396973	hsa-miR-612	CLIP-seq
MIRT2692218	hsa-miR-888	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IEA
GO:0008823	Function	Cupric reductase (NADH) activity	IBA
GO:0008823	Function	Cupric reductase (NADH) activity	IEA
GO:0009055	Function	Electron transfer activity	IDA	30337524
GO:0010008	Component	Endosome membrane	TAS
GO:0015677	Process	Copper ion import	IBA
GO:0015677	Process	Copper ion import	IEA
GO:0016020	Component	Membrane	IDA	30337524
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0020037	Function	Heme binding	IDA	30337524
GO:0031901	Component	Early endosome membrane	IEA
GO:0033212	Process	Iron import into cell	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0052851	Function	Ferric-chelate reductase (NADPH) activity	IBA
GO:0052851	Function	Ferric-chelate reductase (NADPH) activity	IDA	30337524
GO:0052851	Function	Ferric-chelate reductase (NADPH) activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070207	Process	Protein homotrimerization	IDA	30337524
GO:0071949	Function	FAD binding	IDA	30337524

MIM	HGNC	e!Ensembl
611098	21923	ENSG00000127954

Q687X5

Protein name

Metalloreductase STEAP4 (EC 1.16.1.-) (Six-transmembrane epithelial antigen of prostate 4) (SixTransMembrane protein of prostate 2) (Tumor necrosis factor, alpha-induced protein 9)

Protein function

Integral membrane protein that functions as a NADPH-dependent ferric-chelate reductase, using NADPH from one side of the membrane to reduce a Fe(3+) chelate that is bound on the other side of the membrane. Mediates sequential transmembrane elect

PDB

6HCY , 6HD1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03807	F420_oxidored	21 → 107	NADP oxidoreductase coenzyme F420-dependent	Family
PF01794	Ferric_reduct	247 → 395	Ferric reductase like transmembrane component	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in adipose tissue. Expressed in placenta, lung, heart and prostate. Detected at lower levels in liver, skeletal muscle, pancreas, testis and small intestine. Highly expressed in joints of patients with rheu

Sequence

MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPS
GAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEY
LAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQ
GSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAI
SIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGF
AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFV
LLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAY
VLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH

Sequence length

459

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (44)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	22704678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21633911, 29080328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	25683200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24105271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25683200	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	22704678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32802887	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30360481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29078383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29078383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29078383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21849520, 28405880	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21849520, 28405880, 28576871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25646886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27898674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34344926	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25725476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21295959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29078383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	21849520, 26510124, 27706555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28196303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15897894, 25680860, 29190878, 31393902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	25320179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19787193, 27959387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29078383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	28405880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28576871, 29190878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21849520, 26510124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20382686, 21044749, 26510124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19787193, 25680860, 29078383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	25646886, 30366981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18381574, 18430367, 21044749, 21849520, 21933608, 23179203, 23553608, 26510124, 27706555, 27808366, 28405880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21849520, 27808366	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26510124, 27706555, 28405880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	27808366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	30005874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15897894, 25680860, 29190878, 31393902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19787193, 31393902	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	25320179		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29190878		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19660107, 21633911, 25683200, 29080328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	27884600	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25646886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	31648990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

STEAP4 (STEAP4 metalloreductase)