Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79685
Gene name	SAP30 like
Gene symbol	SAP30L
Synonyms (NCBI Gene)	NS4ATP2
Chromosome	5
Chromosome location	5q33.2

197

Show/Hide all (197)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020717	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT048488	hsa-miR-100-5p	CLASH	23622248
MIRT046659	hsa-miR-222-3p	CLASH	23622248
MIRT530919	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT530918	hsa-miR-514a-5p	PAR-CLIP	22012620
MIRT530917	hsa-miR-3664-5p	PAR-CLIP	22012620
MIRT530916	hsa-miR-4502	PAR-CLIP	22012620
MIRT530919	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT530918	hsa-miR-514a-5p	PAR-CLIP	22012620
MIRT530917	hsa-miR-3664-5p	PAR-CLIP	22012620
MIRT530916	hsa-miR-4502	PAR-CLIP	22012620
MIRT1325831	hsa-miR-1	CLIP-seq
MIRT1325832	hsa-miR-1224-3p	CLIP-seq
MIRT1325833	hsa-miR-1237	CLIP-seq
MIRT1325834	hsa-miR-1248	CLIP-seq
MIRT1325835	hsa-miR-1254	CLIP-seq
MIRT1325836	hsa-miR-1260	CLIP-seq
MIRT1325837	hsa-miR-1260b	CLIP-seq
MIRT1325838	hsa-miR-128	CLIP-seq
MIRT1325839	hsa-miR-1280	CLIP-seq
MIRT1325840	hsa-miR-129-3p	CLIP-seq
MIRT1325841	hsa-miR-1324	CLIP-seq
MIRT1325842	hsa-miR-1470	CLIP-seq
MIRT1325843	hsa-miR-150	CLIP-seq
MIRT1325844	hsa-miR-182	CLIP-seq
MIRT1325845	hsa-miR-198	CLIP-seq
MIRT1325846	hsa-miR-206	CLIP-seq
MIRT1325847	hsa-miR-27a	CLIP-seq
MIRT1325848	hsa-miR-27b	CLIP-seq
MIRT1325849	hsa-miR-3065-5p	CLIP-seq
MIRT1325850	hsa-miR-3116	CLIP-seq
MIRT1325851	hsa-miR-3134	CLIP-seq
MIRT1325852	hsa-miR-3166	CLIP-seq
MIRT1325853	hsa-miR-3183	CLIP-seq
MIRT1325854	hsa-miR-3202	CLIP-seq
MIRT1325855	hsa-miR-3646	CLIP-seq
MIRT1325856	hsa-miR-3673	CLIP-seq
MIRT1325857	hsa-miR-3942-3p	CLIP-seq
MIRT1325858	hsa-miR-4287	CLIP-seq
MIRT1325859	hsa-miR-4290	CLIP-seq
MIRT1325860	hsa-miR-4327	CLIP-seq
MIRT1325861	hsa-miR-4329	CLIP-seq
MIRT1325862	hsa-miR-4448	CLIP-seq
MIRT1325863	hsa-miR-4469	CLIP-seq
MIRT1325864	hsa-miR-4470	CLIP-seq
MIRT1325865	hsa-miR-4520a-3p	CLIP-seq
MIRT1325866	hsa-miR-4520b-3p	CLIP-seq
MIRT1325867	hsa-miR-4529-3p	CLIP-seq
MIRT1325868	hsa-miR-4533	CLIP-seq
MIRT1325869	hsa-miR-455-3p	CLIP-seq
MIRT1325870	hsa-miR-4667-3p	CLIP-seq
MIRT1325871	hsa-miR-4685-3p	CLIP-seq
MIRT1325872	hsa-miR-4713-5p	CLIP-seq
MIRT1325873	hsa-miR-4723-3p	CLIP-seq
MIRT1325874	hsa-miR-4778-3p	CLIP-seq
MIRT1325875	hsa-miR-4786-5p	CLIP-seq
MIRT1325876	hsa-miR-520a-5p	CLIP-seq
MIRT1325877	hsa-miR-525-5p	CLIP-seq
MIRT1325878	hsa-miR-532-3p	CLIP-seq
MIRT1325879	hsa-miR-613	CLIP-seq
MIRT1325880	hsa-miR-616	CLIP-seq
MIRT1325881	hsa-miR-769-5p	CLIP-seq
MIRT1325882	hsa-miR-2467-3p	CLIP-seq
MIRT1325849	hsa-miR-3065-5p	CLIP-seq
MIRT1325883	hsa-miR-3606	CLIP-seq
MIRT1325884	hsa-miR-3611	CLIP-seq
MIRT1325855	hsa-miR-3646	CLIP-seq
MIRT1325885	hsa-miR-4257	CLIP-seq
MIRT1325886	hsa-miR-4264	CLIP-seq
MIRT1325887	hsa-miR-4305	CLIP-seq
MIRT1325860	hsa-miR-4327	CLIP-seq
MIRT1325888	hsa-miR-4686	CLIP-seq
MIRT1325889	hsa-miR-4704-3p	CLIP-seq
MIRT1325890	hsa-miR-4712-3p	CLIP-seq
MIRT1325891	hsa-miR-4775	CLIP-seq
MIRT1325892	hsa-miR-4797-3p	CLIP-seq
MIRT1325893	hsa-miR-586	CLIP-seq
MIRT1325894	hsa-miR-624	CLIP-seq
MIRT1325895	hsa-miR-921	CLIP-seq
MIRT1325831	hsa-miR-1	CLIP-seq
MIRT1325832	hsa-miR-1224-3p	CLIP-seq
MIRT1325835	hsa-miR-1254	CLIP-seq
MIRT1325836	hsa-miR-1260	CLIP-seq
MIRT1325837	hsa-miR-1260b	CLIP-seq
MIRT1325839	hsa-miR-1280	CLIP-seq
MIRT1325843	hsa-miR-150	CLIP-seq
MIRT1325896	hsa-miR-1827	CLIP-seq
MIRT1325897	hsa-miR-188-3p	CLIP-seq
MIRT1325898	hsa-miR-2054	CLIP-seq
MIRT1325846	hsa-miR-206	CLIP-seq
MIRT1325849	hsa-miR-3065-5p	CLIP-seq
MIRT1325850	hsa-miR-3116	CLIP-seq
MIRT1325899	hsa-miR-3133	CLIP-seq
MIRT1325852	hsa-miR-3166	CLIP-seq
MIRT1325900	hsa-miR-3200-5p	CLIP-seq
MIRT1325854	hsa-miR-3202	CLIP-seq
MIRT1325901	hsa-miR-330-3p	CLIP-seq
MIRT1325902	hsa-miR-340	CLIP-seq
MIRT1325855	hsa-miR-3646	CLIP-seq
MIRT1325903	hsa-miR-3652	CLIP-seq
MIRT1325904	hsa-miR-3653	CLIP-seq
MIRT1325905	hsa-miR-3658	CLIP-seq
MIRT1325856	hsa-miR-3673	CLIP-seq
MIRT1325906	hsa-miR-3714	CLIP-seq
MIRT1325907	hsa-miR-3914	CLIP-seq
MIRT1325908	hsa-miR-3941	CLIP-seq
MIRT1325909	hsa-miR-4256	CLIP-seq
MIRT1325910	hsa-miR-4289	CLIP-seq
MIRT1325860	hsa-miR-4327	CLIP-seq
MIRT1325911	hsa-miR-4421	CLIP-seq
MIRT1325912	hsa-miR-4430	CLIP-seq
MIRT1325868	hsa-miR-4533	CLIP-seq
MIRT1325913	hsa-miR-4649-3p	CLIP-seq
MIRT1325914	hsa-miR-466	CLIP-seq
MIRT1325870	hsa-miR-4667-3p	CLIP-seq
MIRT1325915	hsa-miR-4670-3p	CLIP-seq
MIRT1325916	hsa-miR-4672	CLIP-seq
MIRT1325872	hsa-miR-4713-5p	CLIP-seq
MIRT1325917	hsa-miR-4731-3p	CLIP-seq
MIRT1325918	hsa-miR-4733-5p	CLIP-seq
MIRT1325919	hsa-miR-4801	CLIP-seq
MIRT1325878	hsa-miR-532-3p	CLIP-seq
MIRT1325920	hsa-miR-548b-3p	CLIP-seq
MIRT1325921	hsa-miR-605	CLIP-seq
MIRT1325879	hsa-miR-613	CLIP-seq
MIRT1325880	hsa-miR-616	CLIP-seq
MIRT1325922	hsa-miR-873	CLIP-seq
MIRT1325923	hsa-miR-891a	CLIP-seq
MIRT1325924	hsa-miR-940	CLIP-seq
MIRT1557007	hsa-miR-1285	CLIP-seq
MIRT1557008	hsa-miR-3187-5p	CLIP-seq
MIRT1557009	hsa-miR-378g	CLIP-seq
MIRT1557010	hsa-miR-4314	CLIP-seq
MIRT1557011	hsa-miR-4486	CLIP-seq
MIRT1557012	hsa-miR-4717-3p	CLIP-seq
MIRT1557013	hsa-miR-513a-5p	CLIP-seq
MIRT1557014	hsa-miR-612	CLIP-seq
MIRT2096699	hsa-miR-1205	CLIP-seq
MIRT1557007	hsa-miR-1285	CLIP-seq
MIRT2096700	hsa-miR-1299	CLIP-seq
MIRT2096701	hsa-miR-3173-5p	CLIP-seq
MIRT1557008	hsa-miR-3187-5p	CLIP-seq
MIRT2096702	hsa-miR-338-5p	CLIP-seq
MIRT1557009	hsa-miR-378g	CLIP-seq
MIRT1557010	hsa-miR-4314	CLIP-seq
MIRT1557011	hsa-miR-4486	CLIP-seq
MIRT2096703	hsa-miR-4695-5p	CLIP-seq
MIRT2096704	hsa-miR-4699-3p	CLIP-seq
MIRT2096705	hsa-miR-4716-3p	CLIP-seq
MIRT1557012	hsa-miR-4717-3p	CLIP-seq
MIRT2096706	hsa-miR-4728-3p	CLIP-seq
MIRT2096707	hsa-miR-4789-3p	CLIP-seq
MIRT1325892	hsa-miR-4797-3p	CLIP-seq
MIRT2096708	hsa-miR-520g	CLIP-seq
MIRT2096709	hsa-miR-520h	CLIP-seq
MIRT1557014	hsa-miR-612	CLIP-seq
MIRT2096710	hsa-miR-767-3p	CLIP-seq
MIRT2096711	hsa-miR-936	CLIP-seq
MIRT1557007	hsa-miR-1285	CLIP-seq
MIRT2321056	hsa-miR-1298	CLIP-seq
MIRT2321057	hsa-miR-1914	CLIP-seq
MIRT2321058	hsa-miR-29a	CLIP-seq
MIRT2321059	hsa-miR-29b	CLIP-seq
MIRT2321060	hsa-miR-29c	CLIP-seq
MIRT1557008	hsa-miR-3187-5p	CLIP-seq
MIRT2321061	hsa-miR-3622a-3p	CLIP-seq
MIRT2321062	hsa-miR-3622b-3p	CLIP-seq
MIRT2321063	hsa-miR-369-3p	CLIP-seq
MIRT2321064	hsa-miR-374a	CLIP-seq
MIRT2321065	hsa-miR-374b	CLIP-seq
MIRT2321066	hsa-miR-374c	CLIP-seq
MIRT1557009	hsa-miR-378g	CLIP-seq
MIRT2321067	hsa-miR-3935	CLIP-seq
MIRT1557010	hsa-miR-4314	CLIP-seq
MIRT1557011	hsa-miR-4486	CLIP-seq
MIRT2321068	hsa-miR-4666-3p	CLIP-seq
MIRT2321069	hsa-miR-4711-5p	CLIP-seq
MIRT2321070	hsa-miR-4796-5p	CLIP-seq
MIRT2321071	hsa-miR-500a	CLIP-seq
MIRT2321072	hsa-miR-548an	CLIP-seq
MIRT1557014	hsa-miR-612	CLIP-seq
MIRT2321073	hsa-miR-655	CLIP-seq
MIRT2394031	hsa-miR-101	CLIP-seq
MIRT2096706	hsa-miR-4728-3p	CLIP-seq
MIRT2440035	hsa-miR-1183	CLIP-seq
MIRT2440036	hsa-miR-4777-3p	CLIP-seq
MIRT2440037	hsa-miR-943	CLIP-seq
MIRT2321058	hsa-miR-29a	CLIP-seq
MIRT2321059	hsa-miR-29b	CLIP-seq
MIRT2321060	hsa-miR-29c	CLIP-seq
MIRT2617139	hsa-miR-3125	CLIP-seq
MIRT2617140	hsa-miR-3916	CLIP-seq
MIRT2321058	hsa-miR-29a	CLIP-seq
MIRT2321059	hsa-miR-29b	CLIP-seq
MIRT2321060	hsa-miR-29c	CLIP-seq
MIRT2617139	hsa-miR-3125	CLIP-seq
MIRT2617140	hsa-miR-3916	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000118	Component	Histone deacetylase complex	IDA	18070604
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18070604
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	9651585, 22865885
GO:0001650	Component	Fibrillar center	IDA
GO:0003677	Function	DNA binding	IDA	19015240, 26609676
GO:0003677	Function	DNA binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	28554894
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	18070604, 19015240
GO:0005730	Component	Nucleolus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0008270	Function	Zinc ion binding	IDA	19015240, 26609676
GO:0008270	Function	Zinc ion binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010314	Function	Phosphatidylinositol-5-phosphate binding	IDA	19015240, 26609676
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0031491	Function	Nucleosome binding	IDA	19015240
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IDA	26609676
GO:0042393	Function	Histone binding	IDA	19015240
GO:0044378	Function	Non-sequence-specific DNA binding, bending	IDA	19015240
GO:0046872	Function	Metal ion binding	IEA
GO:0070273	Function	Phosphatidylinositol-4-phosphate binding	IDA	26609676
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894

MIM	HGNC	e!Ensembl
610398	25663	ENSG00000164576

Q9HAJ7

Protein name

Histone deacetylase complex subunit SAP30L (HCV non-structural protein 4A-transactivated protein 2) (Sin3 corepressor complex subunit SAP30L) (Sin3-associated protein p30-like)

Protein function

[Isoform 1]: Functions as a transcription repressor, probably via its interaction with histone deacetylase complexes (PubMed:16820529, PubMed:18070604). Involved in the functional recruitment of the class 1 Sin3-histone deacetylase complex (HDAC

PDB

2N1U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13866	zf-SAP30	24 → 95	SAP30 zinc-finger	Domain
PF13867	SAP30_Sin3_bdg	114 → 166	Sin3 binding region of histone deacetylase complex subunit SAP30	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain and ovary, and at lower levels in heart, small intestine, lung, kidney, skeletal muscle, stomach and spleen (at protein level) (PubMed:18070604). Ubiquitous; expressed in all tissues tested with highest levels in test

Sequence

MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKL
KLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLR
RYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGK
QLE

Sequence length

183

Interactions

View interactions

	KEGG		Reactome
	Epstein-Barr virus infection		HDACs deacetylate histones

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	28650998	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30820959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27589475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30599235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37335630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	30599235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	29614511	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29614511	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37335630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32664164	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SAP30L (SAP30 like)