Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79683
Gene name	ZDHHC palmitoyltransferase 14
Gene symbol	ZDHHC14
Synonyms (NCBI Gene)	NEW1CP
Chromosome	6
Chromosome location	6q25.3

Show/Hide all (70)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018832	hsa-miR-335-5p	Microarray	18185580
MIRT023040	hsa-miR-124-3p	Microarray	18668037
MIRT054117	hsa-miR-130b-3p	Microarray	22995316
MIRT615691	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT615690	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615689	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT615688	hsa-miR-587	HITS-CLIP	23824327
MIRT615691	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT615690	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT615689	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT615688	hsa-miR-587	HITS-CLIP	23824327
MIRT1507730	hsa-miR-10a	CLIP-seq
MIRT1507731	hsa-miR-10b	CLIP-seq
MIRT1507732	hsa-miR-1227	CLIP-seq
MIRT1507733	hsa-miR-15a	CLIP-seq
MIRT1507734	hsa-miR-15b	CLIP-seq
MIRT1507735	hsa-miR-16	CLIP-seq
MIRT1507736	hsa-miR-1914	CLIP-seq
MIRT1507737	hsa-miR-195	CLIP-seq
MIRT1507738	hsa-miR-3189-3p	CLIP-seq
MIRT1507739	hsa-miR-3194-5p	CLIP-seq
MIRT1507740	hsa-miR-3545-5p	CLIP-seq
MIRT1507741	hsa-miR-3620	CLIP-seq
MIRT1507742	hsa-miR-3647-3p	CLIP-seq
MIRT1507743	hsa-miR-3661	CLIP-seq
MIRT1507744	hsa-miR-424	CLIP-seq
MIRT1507745	hsa-miR-4310	CLIP-seq
MIRT1507746	hsa-miR-4640-5p	CLIP-seq
MIRT1507747	hsa-miR-4691-3p	CLIP-seq
MIRT1507748	hsa-miR-4719	CLIP-seq
MIRT1507749	hsa-miR-4726-5p	CLIP-seq
MIRT1507750	hsa-miR-497	CLIP-seq
MIRT1507751	hsa-miR-502-5p	CLIP-seq
MIRT1507752	hsa-miR-513b	CLIP-seq
MIRT1507753	hsa-miR-593	CLIP-seq
MIRT1507754	hsa-miR-631	CLIP-seq
MIRT1507732	hsa-miR-1227	CLIP-seq
MIRT2373249	hsa-miR-1290	CLIP-seq
MIRT2373250	hsa-miR-194	CLIP-seq
MIRT2373251	hsa-miR-3159	CLIP-seq
MIRT2373252	hsa-miR-3591-3p	CLIP-seq
MIRT2373253	hsa-miR-4715-3p	CLIP-seq
MIRT2373254	hsa-miR-4783-3p	CLIP-seq
MIRT2373255	hsa-miR-651	CLIP-seq
MIRT2397284	hsa-miR-4641	CLIP-seq
MIRT2666081	hsa-miR-3065-5p	CLIP-seq
MIRT2666082	hsa-miR-3117-5p	CLIP-seq
MIRT1507742	hsa-miR-3647-3p	CLIP-seq
MIRT2666083	hsa-miR-3657	CLIP-seq
MIRT2666084	hsa-miR-4264	CLIP-seq
MIRT2666085	hsa-miR-4277	CLIP-seq
MIRT2666086	hsa-miR-4299	CLIP-seq
MIRT2666087	hsa-miR-4325	CLIP-seq
MIRT2666088	hsa-miR-4456	CLIP-seq
MIRT2666089	hsa-miR-4474-5p	CLIP-seq
MIRT2397284	hsa-miR-4641	CLIP-seq
MIRT2666090	hsa-miR-4797-3p	CLIP-seq
MIRT2666091	hsa-miR-4802-5p	CLIP-seq
MIRT2666092	hsa-miR-548q	CLIP-seq
MIRT2666093	hsa-miR-765	CLIP-seq
MIRT2666094	hsa-miR-885-5p	CLIP-seq
MIRT2666081	hsa-miR-3065-5p	CLIP-seq
MIRT2666082	hsa-miR-3117-5p	CLIP-seq
MIRT1507742	hsa-miR-3647-3p	CLIP-seq
MIRT2666084	hsa-miR-4264	CLIP-seq
MIRT2666085	hsa-miR-4277	CLIP-seq
MIRT2666087	hsa-miR-4325	CLIP-seq
MIRT2666089	hsa-miR-4474-5p	CLIP-seq
MIRT2666090	hsa-miR-4797-3p	CLIP-seq
MIRT2666094	hsa-miR-885-5p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	16647879
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0006612	Process	Protein targeting to membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IDA	23034182
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0018230	Process	Peptidyl-L-cysteine S-palmitoylation	IMP	27481942
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IBA
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IC	27481942
GO:0019706	Function	Protein-cysteine S-palmitoyltransferase activity	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA

MIM	HGNC	e!Ensembl
619295	20341	ENSG00000175048

Q8IZN3

Protein name

Palmitoyltransferase ZDHHC14 (EC 2.3.1.225) (DHHC domain-containing cysteine-rich protein 14) (DHHC-14) (NEW1 domain-containing protein) (NEW1CP) (Zinc finger DHHC domain-containing protein 14)

Protein function

Palmitoyltransferase that could catalyze the addition of palmitate onto various protein substrates. May have a palmitoyltransferase activity toward the beta-2 adrenergic receptor/ADRB2 and thereby regulate G protein-coupled receptor signaling (P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01529	DHHC	160 → 289	DHHC palmitoyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16647879}.

Sequence

MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQ
TGVFYLTLVLILVTSGLFFAFDCPYLAVKITPAIPAVAGILFFFVMGTLLRTSFSDPGVL
PRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASH
CSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHVILRSQQTG
FLNALKDSPASVLEAVVCFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYN
PYSYGNIFTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQD
QCIQSTKFVLQAAATPLLQSEPSLTSDELHLPGKPGLGTPCASLTLGPPTPPASMPNLAE
ATLADVMPRKDEHMGHQFLTPDEAPSPPRLLAAGSPLAHSRTMHVLGLASQDSLHEDSVR
GLVKLSSV

Sequence length

488

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Astrocytoma	Astrocytoma	Pubtator	32108034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24407904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24807047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24407904, 24615251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24407904, 24615251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24407904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24807047		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZDHHC14 (zDHHC palmitoyltransferase 14)