Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79674
Gene name	Ventricular zone expressed PH domain containing 1
Gene symbol	VEPH1
Synonyms (NCBI Gene)	MELTVEPH
Chromosome	3
Chromosome location	3q25.31-q25.32

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT755792	hsa-miR-23b-3p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCRELISA	34903122
MIRT1483936	hsa-miR-204	CLIP-seq
MIRT1483937	hsa-miR-211	CLIP-seq
MIRT1483938	hsa-miR-3164	CLIP-seq
MIRT1483939	hsa-miR-3177-5p	CLIP-seq
MIRT1483940	hsa-miR-323-3p	CLIP-seq
MIRT1483941	hsa-miR-361-5p	CLIP-seq
MIRT1483942	hsa-miR-3667-3p	CLIP-seq
MIRT1483943	hsa-miR-374c	CLIP-seq
MIRT1483944	hsa-miR-4263	CLIP-seq
MIRT1483945	hsa-miR-4264	CLIP-seq
MIRT1483946	hsa-miR-4276	CLIP-seq
MIRT1483947	hsa-miR-4302	CLIP-seq
MIRT1483948	hsa-miR-4446-5p	CLIP-seq
MIRT1483949	hsa-miR-4494	CLIP-seq
MIRT1483950	hsa-miR-4509	CLIP-seq
MIRT1483951	hsa-miR-4679	CLIP-seq
MIRT1483952	hsa-miR-4744	CLIP-seq
MIRT1483953	hsa-miR-4755-5p	CLIP-seq
MIRT1483954	hsa-miR-4797-3p	CLIP-seq
MIRT1483955	hsa-miR-4799-5p	CLIP-seq
MIRT1483956	hsa-miR-514	CLIP-seq
MIRT1483957	hsa-miR-514b-3p	CLIP-seq
MIRT1483958	hsa-miR-548m	CLIP-seq
MIRT1483959	hsa-miR-576-5p	CLIP-seq
MIRT1483960	hsa-miR-623	CLIP-seq
MIRT1483961	hsa-miR-655	CLIP-seq
MIRT1483962	hsa-miR-95	CLIP-seq
MIRT1483963	hsa-miR-3129-3p	CLIP-seq
MIRT1483964	hsa-miR-4735-5p	CLIP-seq
MIRT1483965	hsa-miR-1306	CLIP-seq
MIRT1483966	hsa-miR-2276	CLIP-seq
MIRT1483967	hsa-miR-3119	CLIP-seq
MIRT1483968	hsa-miR-3200-5p	CLIP-seq
MIRT1483969	hsa-miR-320a	CLIP-seq
MIRT1483970	hsa-miR-320b	CLIP-seq
MIRT1483971	hsa-miR-320c	CLIP-seq
MIRT1483972	hsa-miR-320d	CLIP-seq
MIRT1483973	hsa-miR-3652	CLIP-seq
MIRT1483974	hsa-miR-378g	CLIP-seq
MIRT1483975	hsa-miR-4283	CLIP-seq
MIRT1483976	hsa-miR-4429	CLIP-seq
MIRT1483977	hsa-miR-4430	CLIP-seq
MIRT1483978	hsa-miR-4489	CLIP-seq
MIRT1483979	hsa-miR-4492	CLIP-seq
MIRT1483980	hsa-miR-4498	CLIP-seq
MIRT1483981	hsa-miR-4505	CLIP-seq
MIRT1483982	hsa-miR-4708-3p	CLIP-seq
MIRT1483983	hsa-miR-4719	CLIP-seq
MIRT1483984	hsa-miR-4729	CLIP-seq
MIRT1483985	hsa-miR-4731-5p	CLIP-seq
MIRT1483986	hsa-miR-4766-5p	CLIP-seq
MIRT1483987	hsa-miR-4795-3p	CLIP-seq
MIRT1483988	hsa-miR-513b	CLIP-seq
MIRT1483989	hsa-miR-647	CLIP-seq
MIRT1483990	hsa-miR-759	CLIP-seq
MIRT1483991	hsa-miR-762	CLIP-seq
MIRT1483992	hsa-miR-767-3p	CLIP-seq
MIRT1483984	hsa-miR-4729	CLIP-seq
MIRT1483987	hsa-miR-4795-3p	CLIP-seq
MIRT2366108	hsa-miR-1229	CLIP-seq
MIRT2366109	hsa-miR-342-3p	CLIP-seq
MIRT2366110	hsa-miR-4778-3p	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	30126976
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0010314	Function	Phosphatidylinositol-5-phosphate binding	IBA
GO:0016020	Component	Membrane	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	26039994
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	26039994

MIM	HGNC	e!Ensembl
609594	25735	ENSG00000197415

Q14D04

Protein name

Ventricular zone-expressed PH domain-containing protein homolog 1 (Protein melted)

Protein function

Interacts with TGF-beta receptor type-1 (TGFBR1) and inhibits dissociation of activated SMAD2 from TGFBR1, impeding its nuclear accumulation and resulting in impaired TGF-beta signaling. May also affect FOXO, Hippo and Wnt signaling. {ECO:000026

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	717 → 819	PH domain	Domain

Sequence

MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEI
CITRITTAIRETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNY
NRPPVMALAIPIAVKFLHRGNKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTM
LLRVLPAVYEKQPQPINRHLTELLALMSQLEQPEQYHLLRLLHVAAKKKQLEVVQKCIPF
LIGHLKDSTHNDIILNILIEIAVYEPVALNSFLPMLKEIGERFPYLTGQMARIYGAVGHV
DEERARSCLTYLVSQLANMEHSFHHILLLEIKSITDTFSSILGPQSRDIFRMSNSFTAIA
KLLTRQLENTKAGSGRRKISTEIEFPEKLEETKLIVTENEDHEKLQVKIQAFEDKINAGS
NTPGSIRRYSLGQVSKEERKNIRFNRSKSLAFHTMLTKGVGSDDGEDENRGDIPASISLS
EIDPLGQGNDKLPFKTDTERSQLGESSVSYPNIIHIDSENLSETVKENSQEETPETTASP
IEYQDKLYLHLKKNLSKVKAYAMEIGKKIPVPDQCTIEDTVRSCVAKLFFTCSLKGHYCL
YSKSSFILISQEPQPWIQIMFLFQQSLFPEPLSIQSHSVQFLRALWEKTQAGGAHSFETA
MMESTFPQQKDLDQVQLHLEEVRFFDVFGFSETAGAWQCFMCNNPEKATVVNQDGQPLIE
GKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDCPIELSKVQSVKAVAKKRR
DRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL

Sequence length

833

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FAMILIAL LONG QT SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (16)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37997542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28301874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31599708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28119515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	33057169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	39684661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28301874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28301874, 31500637		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31599708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28301874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34903122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28301874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36828346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	22822025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	39187920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	11027286		★★★★★ ★☆☆☆☆ Found in Text Mining only

VEPH1 (ventricular zone expressed PH domain containing 1)