Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79669
Gene name	Chromosome 3 open reading frame 52
Gene symbol	C3orf52
Synonyms (NCBI Gene)	HYPT15TTMP
Chromosome	3
Chromosome location	3q13.2

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT538797	hsa-miR-3606-3p	PAR-CLIP	22012620
MIRT538796	hsa-miR-513a-3p	PAR-CLIP	22012620
MIRT538795	hsa-miR-513c-3p	PAR-CLIP	22012620
MIRT538794	hsa-miR-3653-5p	PAR-CLIP	22012620
MIRT538793	hsa-miR-1976	PAR-CLIP	22012620
MIRT538792	hsa-miR-4490	PAR-CLIP	22012620
MIRT538791	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT538790	hsa-miR-4279	PAR-CLIP	22012620
MIRT538789	hsa-miR-629-3p	PAR-CLIP	22012620
MIRT538788	hsa-miR-4446-5p	PAR-CLIP	22012620
MIRT441047	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441047	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT538793	hsa-miR-1976	PAR-CLIP	27292025
MIRT538797	hsa-miR-3606-3p	PAR-CLIP	27292025
MIRT538794	hsa-miR-3653-5p	PAR-CLIP	27292025
MIRT538790	hsa-miR-4279	PAR-CLIP	27292025
MIRT538788	hsa-miR-4446-5p	PAR-CLIP	27292025
MIRT538792	hsa-miR-4490	PAR-CLIP	27292025
MIRT538796	hsa-miR-513a-3p	PAR-CLIP	27292025
MIRT538795	hsa-miR-513c-3p	PAR-CLIP	27292025
MIRT538791	hsa-miR-627-3p	PAR-CLIP	27292025
MIRT538789	hsa-miR-629-3p	PAR-CLIP	27292025
MIRT538797	hsa-miR-3606-3p	PAR-CLIP	22012620
MIRT538796	hsa-miR-513a-3p	PAR-CLIP	22012620
MIRT538795	hsa-miR-513c-3p	PAR-CLIP	22012620
MIRT538794	hsa-miR-3653-5p	PAR-CLIP	22012620
MIRT538793	hsa-miR-1976	PAR-CLIP	22012620
MIRT538792	hsa-miR-4490	PAR-CLIP	22012620
MIRT538791	hsa-miR-627-3p	PAR-CLIP	22012620
MIRT538790	hsa-miR-4279	PAR-CLIP	22012620
MIRT538789	hsa-miR-629-3p	PAR-CLIP	22012620
MIRT538788	hsa-miR-4446-5p	PAR-CLIP	22012620
MIRT847107	hsa-let-7a	CLIP-seq
MIRT847108	hsa-let-7b	CLIP-seq
MIRT847109	hsa-let-7c	CLIP-seq
MIRT847110	hsa-let-7d	CLIP-seq
MIRT847111	hsa-let-7e	CLIP-seq
MIRT847112	hsa-let-7f	CLIP-seq
MIRT847113	hsa-let-7g	CLIP-seq
MIRT847114	hsa-let-7i	CLIP-seq
MIRT847115	hsa-miR-151-5p	CLIP-seq
MIRT847116	hsa-miR-151b	CLIP-seq
MIRT847117	hsa-miR-2278	CLIP-seq
MIRT847118	hsa-miR-28-5p	CLIP-seq
MIRT847119	hsa-miR-3139	CLIP-seq
MIRT847120	hsa-miR-3185	CLIP-seq
MIRT847121	hsa-miR-34b	CLIP-seq
MIRT847122	hsa-miR-34c-3p	CLIP-seq
MIRT847123	hsa-miR-3605-5p	CLIP-seq
MIRT847124	hsa-miR-3662	CLIP-seq
MIRT847125	hsa-miR-3927	CLIP-seq
MIRT847126	hsa-miR-4276	CLIP-seq
MIRT847127	hsa-miR-4447	CLIP-seq
MIRT847128	hsa-miR-4458	CLIP-seq
MIRT847129	hsa-miR-4468	CLIP-seq
MIRT847130	hsa-miR-4472	CLIP-seq
MIRT847131	hsa-miR-4477b	CLIP-seq
MIRT847132	hsa-miR-4500	CLIP-seq
MIRT847133	hsa-miR-4705	CLIP-seq
MIRT847134	hsa-miR-4723-5p	CLIP-seq
MIRT847135	hsa-miR-4762-5p	CLIP-seq
MIRT847136	hsa-miR-4790-3p	CLIP-seq
MIRT847137	hsa-miR-520a-5p	CLIP-seq
MIRT847138	hsa-miR-525-5p	CLIP-seq
MIRT847139	hsa-miR-541	CLIP-seq
MIRT847140	hsa-miR-558	CLIP-seq
MIRT847141	hsa-miR-617	CLIP-seq
MIRT847142	hsa-miR-654-5p	CLIP-seq
MIRT847143	hsa-miR-708	CLIP-seq
MIRT847144	hsa-miR-765	CLIP-seq
MIRT847145	hsa-miR-877	CLIP-seq
MIRT847146	hsa-miR-889	CLIP-seq
MIRT847147	hsa-miR-98	CLIP-seq
MIRT1951334	hsa-miR-27a	CLIP-seq
MIRT1951335	hsa-miR-27b	CLIP-seq
MIRT1951336	hsa-miR-3667-3p	CLIP-seq
MIRT1951337	hsa-miR-3686	CLIP-seq
MIRT1951338	hsa-miR-412	CLIP-seq
MIRT1951339	hsa-miR-4659a-3p	CLIP-seq
MIRT1951340	hsa-miR-4659b-3p	CLIP-seq
MIRT1951341	hsa-miR-513a-5p	CLIP-seq
MIRT847107	hsa-let-7a	CLIP-seq
MIRT847108	hsa-let-7b	CLIP-seq
MIRT847109	hsa-let-7c	CLIP-seq
MIRT847110	hsa-let-7d	CLIP-seq
MIRT847111	hsa-let-7e	CLIP-seq
MIRT847112	hsa-let-7f	CLIP-seq
MIRT847113	hsa-let-7g	CLIP-seq
MIRT847114	hsa-let-7i	CLIP-seq
MIRT2189226	hsa-miR-122	CLIP-seq
MIRT2189227	hsa-miR-1293	CLIP-seq
MIRT847115	hsa-miR-151-5p	CLIP-seq
MIRT847116	hsa-miR-151b	CLIP-seq
MIRT1951334	hsa-miR-27a	CLIP-seq
MIRT1951335	hsa-miR-27b	CLIP-seq
MIRT847118	hsa-miR-28-5p	CLIP-seq
MIRT2189228	hsa-miR-3137	CLIP-seq
MIRT847119	hsa-miR-3139	CLIP-seq
MIRT2189229	hsa-miR-323b-3p	CLIP-seq
MIRT2189230	hsa-miR-3609	CLIP-seq
MIRT847125	hsa-miR-3927	CLIP-seq
MIRT2189231	hsa-miR-3977	CLIP-seq
MIRT1951338	hsa-miR-412	CLIP-seq
MIRT2189232	hsa-miR-4274	CLIP-seq
MIRT847127	hsa-miR-4447	CLIP-seq
MIRT847128	hsa-miR-4458	CLIP-seq
MIRT847130	hsa-miR-4472	CLIP-seq
MIRT2189233	hsa-miR-4474-5p	CLIP-seq
MIRT2189234	hsa-miR-4483	CLIP-seq
MIRT847132	hsa-miR-4500	CLIP-seq
MIRT2189235	hsa-miR-4519	CLIP-seq
MIRT1951339	hsa-miR-4659a-3p	CLIP-seq
MIRT2189236	hsa-miR-4659a-5p	CLIP-seq
MIRT1951340	hsa-miR-4659b-3p	CLIP-seq
MIRT2189237	hsa-miR-4659b-5p	CLIP-seq
MIRT847134	hsa-miR-4723-5p	CLIP-seq
MIRT2189238	hsa-miR-4726-3p	CLIP-seq
MIRT847135	hsa-miR-4762-5p	CLIP-seq
MIRT847136	hsa-miR-4790-3p	CLIP-seq
MIRT2189239	hsa-miR-490-3p	CLIP-seq
MIRT2189240	hsa-miR-508-5p	CLIP-seq
MIRT1951341	hsa-miR-513a-5p	CLIP-seq
MIRT2189241	hsa-miR-520f	CLIP-seq
MIRT847139	hsa-miR-541	CLIP-seq
MIRT2189242	hsa-miR-548ah	CLIP-seq
MIRT847140	hsa-miR-558	CLIP-seq
MIRT2189243	hsa-miR-562	CLIP-seq
MIRT2189244	hsa-miR-649	CLIP-seq
MIRT847142	hsa-miR-654-5p	CLIP-seq
MIRT847143	hsa-miR-708	CLIP-seq
MIRT2189245	hsa-miR-873	CLIP-seq
MIRT847145	hsa-miR-877	CLIP-seq
MIRT847147	hsa-miR-98	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32336749, 33961781
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IDA	32336749
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
611956	26255	ENSG00000114529

Q5BVD1

Protein name

TPA-induced transmembrane protein

Protein function

Has a role in LIPH-mediated synthesis of 2-acyl lysophosphatidic acid (LPA). LPA is a bioactive lipid mediator involved in different biological processes, and necessary to promote hair formation and growth.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected predominantly in the skin, with strongest expression in the inner root sheath of the hair follicle. {ECO:0000269|PubMed:32336749}.

Sequence

MDLAQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNV
VGRCKLWMIITSIFLGVITVIIIGLCLAAVTYVDEDENEILELSSNKTFFIMLKIPEECV
AEEELPHLLTERLTDVYSTSPSLGRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKY
MMSEELVLGILLQDFRDQNIPGCESLGLDPTSLLLYE

Sequence length

217

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypotrichosis 15	Pathogenic	rs545208237, rs764787339, rs2472299130	RCV002472348 RCV002472349 RCV002472350	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	29271998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

C3orf52 (chromosome 3 open reading frame 52)