Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79658
Gene name	Rho GTPase activating protein 10
Gene symbol	ARHGAP10
Synonyms (NCBI Gene)	GRAF2PS-GAPPSGAP
Chromosome	4
Chromosome location	4q31.23

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051013	hsa-miR-17-5p	CLASH	23622248
MIRT437670	hsa-miR-214-3p	MicroarrayqRT-PCR	22815788
MIRT793542	hsa-miR-128	CLIP-seq
MIRT793543	hsa-miR-27a	CLIP-seq
MIRT793544	hsa-miR-27b	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT793546	hsa-miR-4277	CLIP-seq
MIRT793547	hsa-miR-4667-3p	CLIP-seq
MIRT793548	hsa-miR-4705	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT793550	hsa-miR-640	CLIP-seq
MIRT1934153	hsa-miR-1915	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT1934154	hsa-miR-361-3p	CLIP-seq
MIRT1934155	hsa-miR-3665	CLIP-seq
MIRT1934156	hsa-miR-3929	CLIP-seq
MIRT1934157	hsa-miR-4419b	CLIP-seq
MIRT1934158	hsa-miR-4478	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT1934159	hsa-miR-623	CLIP-seq
MIRT1934160	hsa-miR-645	CLIP-seq
MIRT1934161	hsa-miR-765	CLIP-seq
MIRT2174019	hsa-miR-1304	CLIP-seq
MIRT2174020	hsa-miR-1827	CLIP-seq
MIRT2174021	hsa-miR-2276	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT2174022	hsa-miR-3148	CLIP-seq
MIRT2174023	hsa-miR-3150b-3p	CLIP-seq
MIRT2174024	hsa-miR-34c-3p	CLIP-seq
MIRT2174025	hsa-miR-3978	CLIP-seq
MIRT2174026	hsa-miR-4694-5p	CLIP-seq
MIRT2174027	hsa-miR-4772-3p	CLIP-seq
MIRT2174028	hsa-miR-4784	CLIP-seq
MIRT2174029	hsa-miR-570	CLIP-seq
MIRT2174030	hsa-miR-602	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT2477606	hsa-miR-1261	CLIP-seq
MIRT2477607	hsa-miR-1266	CLIP-seq
MIRT2477608	hsa-miR-1273	CLIP-seq
MIRT2477609	hsa-miR-1287	CLIP-seq
MIRT2477610	hsa-miR-1321	CLIP-seq
MIRT2477611	hsa-miR-15a	CLIP-seq
MIRT2477612	hsa-miR-15b	CLIP-seq
MIRT2477613	hsa-miR-16	CLIP-seq
MIRT2477614	hsa-miR-195	CLIP-seq
MIRT2477615	hsa-miR-204	CLIP-seq
MIRT2477616	hsa-miR-211	CLIP-seq
MIRT2477617	hsa-miR-214	CLIP-seq
MIRT2174021	hsa-miR-2276	CLIP-seq
MIRT2477618	hsa-miR-298	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT2477619	hsa-miR-3135b	CLIP-seq
MIRT2174023	hsa-miR-3150b-3p	CLIP-seq
MIRT2174024	hsa-miR-34c-3p	CLIP-seq
MIRT2477620	hsa-miR-3612	CLIP-seq
MIRT2477621	hsa-miR-3619-5p	CLIP-seq
MIRT1934155	hsa-miR-3665	CLIP-seq
MIRT2477622	hsa-miR-3907	CLIP-seq
MIRT2477623	hsa-miR-424	CLIP-seq
MIRT2477624	hsa-miR-4270	CLIP-seq
MIRT2477625	hsa-miR-4290	CLIP-seq
MIRT2477626	hsa-miR-4441	CLIP-seq
MIRT2477627	hsa-miR-4443	CLIP-seq
MIRT2477628	hsa-miR-4469	CLIP-seq
MIRT2477629	hsa-miR-4518	CLIP-seq
MIRT2477630	hsa-miR-4668-3p	CLIP-seq
MIRT2477631	hsa-miR-4728-3p	CLIP-seq
MIRT2477632	hsa-miR-4739	CLIP-seq
MIRT2477633	hsa-miR-4755-5p	CLIP-seq
MIRT2477634	hsa-miR-4756-5p	CLIP-seq
MIRT2174027	hsa-miR-4772-3p	CLIP-seq
MIRT2174028	hsa-miR-4784	CLIP-seq
MIRT2477635	hsa-miR-497	CLIP-seq
MIRT2477636	hsa-miR-552	CLIP-seq
MIRT2477637	hsa-miR-582-5p	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT1934159	hsa-miR-623	CLIP-seq
MIRT2477638	hsa-miR-642a	CLIP-seq
MIRT2477639	hsa-miR-650	CLIP-seq
MIRT2477640	hsa-miR-761	CLIP-seq
MIRT2477641	hsa-miR-764	CLIP-seq
MIRT1934161	hsa-miR-765	CLIP-seq
MIRT2477606	hsa-miR-1261	CLIP-seq
MIRT2477608	hsa-miR-1273	CLIP-seq
MIRT793542	hsa-miR-128	CLIP-seq
MIRT2477609	hsa-miR-1287	CLIP-seq
MIRT2675254	hsa-miR-147	CLIP-seq
MIRT2477615	hsa-miR-204	CLIP-seq
MIRT2477616	hsa-miR-211	CLIP-seq
MIRT2174021	hsa-miR-2276	CLIP-seq
MIRT793543	hsa-miR-27a	CLIP-seq
MIRT793544	hsa-miR-27b	CLIP-seq
MIRT2477618	hsa-miR-298	CLIP-seq
MIRT793545	hsa-miR-3064-3p	CLIP-seq
MIRT2477619	hsa-miR-3135b	CLIP-seq
MIRT2174024	hsa-miR-34c-3p	CLIP-seq
MIRT2477620	hsa-miR-3612	CLIP-seq
MIRT2675255	hsa-miR-3911	CLIP-seq
MIRT793546	hsa-miR-4277	CLIP-seq
MIRT2477625	hsa-miR-4290	CLIP-seq
MIRT2477627	hsa-miR-4443	CLIP-seq
MIRT2675256	hsa-miR-4466	CLIP-seq
MIRT2477628	hsa-miR-4469	CLIP-seq
MIRT793547	hsa-miR-4667-3p	CLIP-seq
MIRT2477630	hsa-miR-4668-3p	CLIP-seq
MIRT793548	hsa-miR-4705	CLIP-seq
MIRT2477631	hsa-miR-4728-3p	CLIP-seq
MIRT2477633	hsa-miR-4755-5p	CLIP-seq
MIRT2174027	hsa-miR-4772-3p	CLIP-seq
MIRT2477636	hsa-miR-552	CLIP-seq
MIRT2477637	hsa-miR-582-5p	CLIP-seq
MIRT793549	hsa-miR-603	CLIP-seq
MIRT1934159	hsa-miR-623	CLIP-seq
MIRT793550	hsa-miR-640	CLIP-seq
MIRT2477638	hsa-miR-642a	CLIP-seq
MIRT2675257	hsa-miR-644	CLIP-seq
MIRT2477639	hsa-miR-650	CLIP-seq
MIRT2675258	hsa-miR-675	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	11432776, 32344433, 32707033
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	32344433
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0007010	Process	Cytoskeleton organization	IBA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0010008	Component	Endosome membrane	IDA	32344433
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
609746	26099	ENSG00000071205

A1A4S6

Protein name

Rho GTPase-activating protein 10 (GTPase regulator associated with focal adhesion kinase 2) (GRAF2) (Graf-related protein 2) (Rho-type GTPase-activating protein 10)

Protein function

GTPase-activating protein that catalyzes the conversion of active GTP-bound Rho GTPases to their inactive GDP-bound form, thus suppressing various Rho GTPase-mediated cellular processes (PubMed:11432776). Also converts Cdc42 to an inactive GDP-b

PDB

2MIO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16746	BAR_3	6 → 249		Domain
PF00169	PH	266 → 369	PH domain	Domain
PF00620	RhoGAP	397 → 551	RhoGAP domain	Domain
PF14604	SH3_9	735 → 784	Variant SH3 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High levels of expression in heart and skeletal muscle. {ECO:0000269|PubMed:11432776}.

Sequence

MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKF
AHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKF
NMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEER
KQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVV
GVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFI
VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGP
TLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQS
KRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKN
HLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPFSPPATV
ADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQ
NYVKLL

Sequence length

786

Interactions

View interactions

	KEGG		Reactome
	Bacterial invasion of epithelial cells		Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPIDERMOLYSIS BULLOSA SIMPLEX 5D, GENERALIZED INTERMEDIATE, AUTOSOMAL RECESSIVE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermolysis bullosa simplex with nail dystrophy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20332263, 31396458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28943961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27010858, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20332263, 31396458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28943961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27010858, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27010858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27010858, 28943961, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31561126		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27010858, 31445707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	35624318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGAP10 (Rho GTPase activating protein 10)