Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79625
Gene name	Neuron derived neurotrophic factor
Gene symbol	NDNF
Synonyms (NCBI Gene)	C4orf31HH25NORD
Chromosome	4
Chromosome location	4q27

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT655970	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT655969	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT655968	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT655967	hsa-miR-3183	HITS-CLIP	23824327
MIRT655966	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT655964	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT655965	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT655963	hsa-miR-1260a	HITS-CLIP	23824327
MIRT655962	hsa-miR-1260b	HITS-CLIP	23824327
MIRT655961	hsa-miR-578	HITS-CLIP	23824327
MIRT655960	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT527999	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT527998	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT527997	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT527996	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527995	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT527994	hsa-miR-6844	PAR-CLIP	22012620
MIRT527993	hsa-miR-607	PAR-CLIP	22012620
MIRT527992	hsa-miR-1305	PAR-CLIP	22012620
MIRT527991	hsa-miR-335-3p	PAR-CLIP	22012620
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT655970	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT655969	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT655968	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT655967	hsa-miR-3183	HITS-CLIP	23824327
MIRT655966	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT655964	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT655965	hsa-miR-4662a-5p	HITS-CLIP	23824327
MIRT655963	hsa-miR-1260a	HITS-CLIP	23824327
MIRT655962	hsa-miR-1260b	HITS-CLIP	23824327
MIRT655961	hsa-miR-578	HITS-CLIP	23824327
MIRT655960	hsa-miR-6826-3p	HITS-CLIP	23824327
MIRT527999	hsa-miR-4714-5p	PAR-CLIP	22012620
MIRT527998	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT527997	hsa-miR-4670-3p	PAR-CLIP	22012620
MIRT527996	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527995	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT527994	hsa-miR-6844	PAR-CLIP	22012620
MIRT527993	hsa-miR-607	PAR-CLIP	22012620
MIRT527992	hsa-miR-1305	PAR-CLIP	22012620
MIRT527991	hsa-miR-335-3p	PAR-CLIP	22012620
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT445363	hsa-miR-224-3p	PAR-CLIP	22100165
MIRT445362	hsa-miR-522-3p	PAR-CLIP	22100165
MIRT445361	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT445359	hsa-miR-4635	PAR-CLIP	22100165
MIRT445360	hsa-miR-3185	PAR-CLIP	22100165
MIRT445358	hsa-miR-4709-3p	PAR-CLIP	22100165
MIRT1178048	hsa-miR-1206	CLIP-seq
MIRT1178049	hsa-miR-139-5p	CLIP-seq
MIRT1178050	hsa-miR-3125	CLIP-seq
MIRT1178051	hsa-miR-3168	CLIP-seq
MIRT1178052	hsa-miR-33a	CLIP-seq
MIRT1178053	hsa-miR-33b	CLIP-seq
MIRT1178054	hsa-miR-3690	CLIP-seq
MIRT1178055	hsa-miR-3916	CLIP-seq
MIRT1178056	hsa-miR-4254	CLIP-seq
MIRT1178057	hsa-miR-4653-3p	CLIP-seq
MIRT1178058	hsa-miR-4790-3p	CLIP-seq
MIRT1178059	hsa-miR-4797-5p	CLIP-seq
MIRT1178060	hsa-miR-513a-3p	CLIP-seq
MIRT2438966	hsa-miR-1324	CLIP-seq
MIRT2438967	hsa-miR-4711-5p	CLIP-seq
MIRT1178052	hsa-miR-33a	CLIP-seq
MIRT1178053	hsa-miR-33b	CLIP-seq
MIRT2454964	hsa-miR-4265	CLIP-seq
MIRT2454965	hsa-miR-4296	CLIP-seq
MIRT2454966	hsa-miR-4322	CLIP-seq
MIRT2454967	hsa-miR-4455	CLIP-seq
MIRT2454968	hsa-miR-609	CLIP-seq
MIRT1178052	hsa-miR-33a	CLIP-seq
MIRT1178053	hsa-miR-33b	CLIP-seq
MIRT2454964	hsa-miR-4265	CLIP-seq
MIRT2454965	hsa-miR-4296	CLIP-seq
MIRT2454966	hsa-miR-4322	CLIP-seq
MIRT2454967	hsa-miR-4455	CLIP-seq
MIRT2454968	hsa-miR-609	CLIP-seq
MIRT2438966	hsa-miR-1324	CLIP-seq
MIRT2579067	hsa-miR-205	CLIP-seq
MIRT2579068	hsa-miR-335	CLIP-seq
MIRT2579069	hsa-miR-3675-5p	CLIP-seq
MIRT2579070	hsa-miR-4704-5p	CLIP-seq
MIRT2438967	hsa-miR-4711-5p	CLIP-seq
MIRT2579071	hsa-miR-4773	CLIP-seq
MIRT2579072	hsa-miR-486-3p	CLIP-seq
MIRT2579073	hsa-miR-603	CLIP-seq
MIRT2438966	hsa-miR-1324	CLIP-seq
MIRT2579067	hsa-miR-205	CLIP-seq
MIRT2686018	hsa-miR-329	CLIP-seq
MIRT2579068	hsa-miR-335	CLIP-seq
MIRT2686019	hsa-miR-362-3p	CLIP-seq
MIRT2579069	hsa-miR-3675-5p	CLIP-seq
MIRT2686020	hsa-miR-3941	CLIP-seq
MIRT2686021	hsa-miR-410	CLIP-seq
MIRT2579070	hsa-miR-4704-5p	CLIP-seq
MIRT2438967	hsa-miR-4711-5p	CLIP-seq
MIRT2579071	hsa-miR-4773	CLIP-seq
MIRT2686022	hsa-miR-4789-5p	CLIP-seq
MIRT2579072	hsa-miR-486-3p	CLIP-seq
MIRT2579073	hsa-miR-603	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	24706764
GO:0001764	Process	Neuron migration	IDA	20969804
GO:0002931	Process	Response to ischemia	IEA
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	ISS
GO:0005576	Component	Extracellular region	IDA	20969804
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	35037619
GO:0005615	Component	Extracellular space	IDA	31883645
GO:0007263	Process	Nitric oxide mediated signal transduction	IDA	24706764
GO:0007399	Process	Nervous system development	IEA
GO:0008201	Function	Heparin binding	IBA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	ISS
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	ISS
GO:0010976	Process	Positive regulation of neuron projection development	IDA	20969804
GO:0021828	Process	Gonadotrophin-releasing hormone neuronal migration to the hypothalamus	IEA
GO:0021828	Process	Gonadotrophin-releasing hormone neuronal migration to the hypothalamus	ISS
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030198	Process	Extracellular matrix organization	ISS
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	20969804
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IMP	31883645
GO:0061042	Process	Vascular wound healing	IEA
GO:0061042	Process	Vascular wound healing	ISS
GO:0071456	Process	Cellular response to hypoxia	IDA	24706764
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	24706764

MIM	HGNC	e!Ensembl
616506	26256	ENSG00000173376

Q8TB73

Protein name

Protein NDNF (Neuron-derived neurotrophic factor)

Protein function

Secretory protein that plays a role in various cellular processes (PubMed:20969804, PubMed:24706764, PubMed:31883645). Acts as a chemorepellent acting on gonadotropin-releasing hormone (GnRH) expressing neurons regulating their migration to the

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10179	DUF2369	291 → 383	Uncharacterised conserved protein (DUF2369)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in neurons along the gonadotropin-releasing hormone (GnRH) expressing neurons migratory route. {ECO:0000269|PubMed:31883645}.

Sequence

MVLLHWCLLWLLFPLSSRTQKLPTRDEELFQMQIRDKAFFHDSSVIPDGAEISSYLFRDT
PKRYFFVVEEDNTPLSVTVTPCDAPLEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINE
EGTELFSYKGNDVEYFISSSSPSGLYQLDLLSTEKDTHFKVYATTTPESDQPYPELPYDP
RVDVTSLGRTTVTLAWKPSPTASLLKQPIQYCVVINKEHNFKSLCAVEAKLSADDAFMMA
PKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFT
VSDLKPDTQYYFDVFVVNINSNMSTAYVGTFARTKEEAKQKTVELKDGKITDVFVKRKGA
KFLRFAPVSSHQKVTFFIHSCLDAVQIQVRRDGKLLLSQNVEGIQQFQLRGKPKAKYLVR
LKGNKKGASMLKILATTRPTKQSFPSLPEDTRIKAFDKLRTCSSATVAWLGTQERNKFCI
YKKEVDDNYNEDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGKS
YLLDVYVIGHGGHSVKYQSKVVKTRKFC

Sequence length

568

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypogonadotropic hypogonadism 25 with anosmia	Likely pathogenic; Pathogenic	rs2476439283, rs1727077385, rs1726901153, rs1726871489	RCV002290153 RCV001034704 RCV001034705 RCV001034706	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC GROWTH HORMONE DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KALLMANN SYNDROME	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANHYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY DWARFISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY SHORT STATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHEEHAN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
cervical cancer	Cervical Cancer	BEFREE	29572178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29572178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30867731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36092962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Germ cell tumor	Tumor	BEFREE	28893722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann syndrome	Kallmann Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of cervix	Cervical Tumor	BEFREE	29572178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31287219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	38340697	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30867731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	24706764		★★★★★ ★☆☆☆☆ Found in Text Mining only

NDNF (neuron derived neurotrophic factor)