Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79611
Gene name	Acyl-CoA synthetase short chain family member 3
Gene symbol	ACSS3
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q21.31

131

Show/Hide all (131)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017832	hsa-miR-335-5p	Microarray	18185580
MIRT539516	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT539515	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT539514	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT539513	hsa-miR-23c	PAR-CLIP	22012620
MIRT539512	hsa-miR-7849-3p	PAR-CLIP	22012620
MIRT539511	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT539510	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT539509	hsa-miR-4480	PAR-CLIP	22012620
MIRT539508	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT539507	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT539506	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT539505	hsa-miR-507	PAR-CLIP	22012620
MIRT539504	hsa-miR-557	PAR-CLIP	22012620
MIRT539503	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT539516	hsa-miR-130a-5p	PAR-CLIP	22012620
MIRT539515	hsa-miR-23b-3p	PAR-CLIP	22012620
MIRT539514	hsa-miR-23a-3p	PAR-CLIP	22012620
MIRT539513	hsa-miR-23c	PAR-CLIP	22012620
MIRT539512	hsa-miR-7849-3p	PAR-CLIP	22012620
MIRT539511	hsa-miR-1250-3p	PAR-CLIP	22012620
MIRT539510	hsa-miR-153-5p	PAR-CLIP	22012620
MIRT539509	hsa-miR-4480	PAR-CLIP	22012620
MIRT539508	hsa-miR-579-3p	PAR-CLIP	22012620
MIRT539507	hsa-miR-664b-3p	PAR-CLIP	22012620
MIRT539506	hsa-miR-450b-5p	PAR-CLIP	22012620
MIRT539505	hsa-miR-507	PAR-CLIP	22012620
MIRT539504	hsa-miR-557	PAR-CLIP	22012620
MIRT539503	hsa-miR-3680-3p	PAR-CLIP	22012620
MIRT763724	hsa-miR-1273f	CLIP-seq
MIRT763725	hsa-miR-1289	CLIP-seq
MIRT763726	hsa-miR-1323	CLIP-seq
MIRT763727	hsa-miR-143	CLIP-seq
MIRT763728	hsa-miR-2052	CLIP-seq
MIRT763729	hsa-miR-3198	CLIP-seq
MIRT763730	hsa-miR-3664-5p	CLIP-seq
MIRT763731	hsa-miR-4294	CLIP-seq
MIRT763732	hsa-miR-4309	CLIP-seq
MIRT763733	hsa-miR-4534	CLIP-seq
MIRT763734	hsa-miR-4708-5p	CLIP-seq
MIRT763735	hsa-miR-4714-5p	CLIP-seq
MIRT763736	hsa-miR-4770	CLIP-seq
MIRT763737	hsa-miR-548o	CLIP-seq
MIRT763738	hsa-miR-550b	CLIP-seq
MIRT763739	hsa-miR-924	CLIP-seq
MIRT1925104	hsa-miR-197	CLIP-seq
MIRT1925105	hsa-miR-24	CLIP-seq
MIRT1925106	hsa-miR-3155	CLIP-seq
MIRT1925107	hsa-miR-3155b	CLIP-seq
MIRT1925108	hsa-miR-3187-3p	CLIP-seq
MIRT1925109	hsa-miR-4284	CLIP-seq
MIRT1925110	hsa-miR-4435	CLIP-seq
MIRT1925111	hsa-miR-4701-5p	CLIP-seq
MIRT1925112	hsa-miR-4716-5p	CLIP-seq
MIRT1925113	hsa-miR-4755-3p	CLIP-seq
MIRT1925114	hsa-miR-4772-3p	CLIP-seq
MIRT1925115	hsa-miR-4781-3p	CLIP-seq
MIRT1925116	hsa-miR-484	CLIP-seq
MIRT1925117	hsa-miR-5096	CLIP-seq
MIRT1925118	hsa-miR-548s	CLIP-seq
MIRT1925119	hsa-miR-548v	CLIP-seq
MIRT1925120	hsa-miR-588	CLIP-seq
MIRT1925121	hsa-miR-630	CLIP-seq
MIRT1925122	hsa-miR-643	CLIP-seq
MIRT2166622	hsa-miR-106a	CLIP-seq
MIRT2166623	hsa-miR-106b	CLIP-seq
MIRT2166624	hsa-miR-150	CLIP-seq
MIRT2166625	hsa-miR-17	CLIP-seq
MIRT2166626	hsa-miR-20a	CLIP-seq
MIRT2166627	hsa-miR-20b	CLIP-seq
MIRT2166628	hsa-miR-23a	CLIP-seq
MIRT2166629	hsa-miR-23b	CLIP-seq
MIRT2166630	hsa-miR-4258	CLIP-seq
MIRT2166631	hsa-miR-4763-5p	CLIP-seq
MIRT2166632	hsa-miR-519d	CLIP-seq
MIRT2166633	hsa-miR-520g	CLIP-seq
MIRT2166634	hsa-miR-520h	CLIP-seq
MIRT2166635	hsa-miR-579	CLIP-seq
MIRT2166636	hsa-miR-93	CLIP-seq
MIRT2469045	hsa-miR-1275	CLIP-seq
MIRT2469046	hsa-miR-1297	CLIP-seq
MIRT2469047	hsa-miR-199a-3p	CLIP-seq
MIRT2469048	hsa-miR-199b-3p	CLIP-seq
MIRT1925105	hsa-miR-24	CLIP-seq
MIRT2469049	hsa-miR-26a	CLIP-seq
MIRT2469050	hsa-miR-26b	CLIP-seq
MIRT2469051	hsa-miR-3129-5p	CLIP-seq
MIRT2469052	hsa-miR-3135b	CLIP-seq
MIRT2469053	hsa-miR-3149	CLIP-seq
MIRT2469054	hsa-miR-3652	CLIP-seq
MIRT2166630	hsa-miR-4258	CLIP-seq
MIRT2469055	hsa-miR-4272	CLIP-seq
MIRT2469056	hsa-miR-4279	CLIP-seq
MIRT1925109	hsa-miR-4284	CLIP-seq
MIRT2469057	hsa-miR-4430	CLIP-seq
MIRT2469058	hsa-miR-4447	CLIP-seq
MIRT2469059	hsa-miR-4465	CLIP-seq
MIRT2469060	hsa-miR-4471	CLIP-seq
MIRT2469061	hsa-miR-4472	CLIP-seq
MIRT2469062	hsa-miR-4525	CLIP-seq
MIRT2469063	hsa-miR-4665-5p	CLIP-seq
MIRT1925112	hsa-miR-4716-5p	CLIP-seq
MIRT2469064	hsa-miR-4723-5p	CLIP-seq
MIRT1925114	hsa-miR-4772-3p	CLIP-seq
MIRT2469065	hsa-miR-502-5p	CLIP-seq
MIRT2469066	hsa-miR-577	CLIP-seq
MIRT2469067	hsa-miR-625	CLIP-seq
MIRT1925121	hsa-miR-630	CLIP-seq
MIRT1925122	hsa-miR-643	CLIP-seq
MIRT2469068	hsa-miR-936	CLIP-seq
MIRT2469045	hsa-miR-1275	CLIP-seq
MIRT2469046	hsa-miR-1297	CLIP-seq
MIRT1925105	hsa-miR-24	CLIP-seq
MIRT2469049	hsa-miR-26a	CLIP-seq
MIRT2469050	hsa-miR-26b	CLIP-seq
MIRT2469053	hsa-miR-3149	CLIP-seq
MIRT2674335	hsa-miR-3152-5p	CLIP-seq
MIRT2166630	hsa-miR-4258	CLIP-seq
MIRT2469055	hsa-miR-4272	CLIP-seq
MIRT2469056	hsa-miR-4279	CLIP-seq
MIRT1925109	hsa-miR-4284	CLIP-seq
MIRT2469059	hsa-miR-4465	CLIP-seq
MIRT2469060	hsa-miR-4471	CLIP-seq
MIRT2469062	hsa-miR-4525	CLIP-seq
MIRT2469063	hsa-miR-4665-5p	CLIP-seq
MIRT2469064	hsa-miR-4723-5p	CLIP-seq
MIRT1925114	hsa-miR-4772-3p	CLIP-seq
MIRT2469065	hsa-miR-502-5p	CLIP-seq
MIRT2469067	hsa-miR-625	CLIP-seq
MIRT1925121	hsa-miR-630	CLIP-seq
MIRT1925122	hsa-miR-643	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003987	Function	Acetate-CoA ligase activity	IEA
GO:0003987	Function	Acetate-CoA ligase activity	ISS
GO:0003987	Function	Acetate-CoA ligase activity	TAS
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	28003429
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0016874	Function	Ligase activity	IEA
GO:0031956	Function	Medium-chain fatty acid-CoA ligase activity	IEA
GO:0031956	Function	Medium-chain fatty acid-CoA ligase activity	ISS
GO:0046951	Process	Ketone body biosynthetic process	TAS
GO:0050218	Function	Propionate-CoA ligase activity	IBA
GO:0050218	Function	Propionate-CoA ligase activity	IDA	28003429
GO:0050218	Function	Propionate-CoA ligase activity	IEA

MIM	HGNC	e!Ensembl
614356	24723	ENSG00000111058

Q9H6R3

Protein name

Acyl-CoA synthetase short-chain family member 3, mitochondrial (EC 6.2.1.1) (Acetate--CoA ligase 3) (Acyl-CoA synthetase short-chain family member 3) (Propionate--CoA ligase) (EC 6.2.1.17)

Protein function

Catalyzes the synthesis of acetyl-CoA from short-chain fatty acids (PubMed:28003429). Propionate is the preferred substrate (PubMed:28003429). Can utilize acetate and butyrate with a much lower affinity (By similarity). {ECO:0000250|UniProtKB:A0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16177	ACAS_N	62 → 116	Acetyl-coenzyme A synthetase N-terminus	Family
PF00501	AMP-binding	117 → 562	AMP-binding enzyme	Family
PF13193	AMP-binding_C	570 → 649	AMP-binding enzyme C-terminal domain	Domain

Sequence

MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGS
EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRH
IENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQ
AMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEE
ALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTS
GTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGN
TTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKT
LFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVP
GYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDA
GYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLA
LCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVN
GKPYKITSTIEDPSIFGHVEEMLKQA

Sequence length

686

Interactions

View interactions

	KEGG		Reactome
	Propanoate metabolism Metabolic pathways		Synthesis of Ketone Bodies

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30482855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Adenoma	Conn Adenoma	BEFREE	27777363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30718454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	27777363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29493120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29493120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33383577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29493120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23034519	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	39754905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29493120		★★★★★ ★☆☆☆☆ Found in Text Mining only

ACSS3 (acyl-CoA synthetase short chain family member 3)