Gene Gene information from NCBI Gene database.
Entrez ID 79608
Gene name RIC3 acetylcholine receptor chaperone
Gene symbol RIC3
Synonyms (NCBI Gene)
AYST720PRO1385RIC-3
Chromosome 11
Chromosome location 11p15.4
Summary This gene encodes a member of the resistance to inhibitors of cholinesterase 3-like family which functions as a chaperone of specific 5-hydroxytryptamine type 3 receptor and nicotinic acetylcholine receptor subtypes. The encoded protein influences the fol
miRNA miRNA information provided by mirtarbase database.
108
miRTarBase ID miRNA Experiments Reference
MIRT1306399 hsa-miR-125a-3p CLIP-seq
MIRT1306400 hsa-miR-1266 CLIP-seq
MIRT739891 hsa-miR-2117 CLIP-seq
MIRT739890 hsa-miR-2276 CLIP-seq
MIRT739887 hsa-miR-3145-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610509 30338 ENSG00000166405
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z5B4
Protein name Protein RIC-3 (Resistant to inhibitor of cholinesterase 3)
Protein function Molecular chaperone which facilitates proper subunit assembly and surface trafficking of alpha-7 (CHRNA7) and alpha-8 (CHRNA8) nicotinic acetylcholine receptors (PubMed:12821669, PubMed:15504725, PubMed:16120769, PubMed:18691158, PubMed:32204458
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15361 RIC3 15 166 Resistance to inhibitors of cholinesterase homologue 3 Family
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, with high levels in muscle, brain, heart, pancreas and testis. In the central nervous system, highest levels are detected in the cerebellum and pituitary gland. Over-expressed in brains from patients with bipolar dis
Sequence
MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAPSDG
QTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSK
GKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLIN
RVGPNGESRAQTVT
SDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIK
RRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKP
ETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSML
RKRNPQGLE
Sequence length 369
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MOVEMENT DISORDER GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE Disgenet, GenCC
Disgenet, GenCC
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
RIC3-related disorder Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer UNIPROT_DG
★☆☆☆☆
Found in Text Mining only
Multiple Sclerosis Multiple Sclerosis BEFREE 23412934
★☆☆☆☆
Found in Text Mining only
Multiple Sclerosis Multiple sclerosis Pubtator 23412934 Associate
★☆☆☆☆
Found in Text Mining only
Obesity Obesity Pubtator 16443771 Associate
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 39639217 Associate
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease BEFREE 27055476, 28153381, 28606768
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ST segment elevation myocardial infarction ST Segment Elevation Myocardial Infarction BEFREE 29516192
★☆☆☆☆
Found in Text Mining only