CALCA (calcitonin related polypeptide alpha)

Gene

• Entrez ID: 796
• Gene name: Calcitonin related polypeptide alpha
• Gene symbol: CALCA
• Synonyms (NCBI Gene): CALC1, CGRP, CGRP-I, CGRP-alpha, CGRP1, CT, KC, PCT
• Chromosome: 11
• Chromosome location: 11p15.2
• Summary: This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT858811	hsa-miR-1297	CLIP-seq
MIRT858812	hsa-miR-26a	CLIP-seq
MIRT858813	hsa-miR-26b	CLIP-seq
MIRT858814	hsa-miR-409-5p	CLIP-seq
MIRT858815	hsa-miR-4465	CLIP-seq
MIRT1954963	hsa-miR-1283	CLIP-seq
MIRT1954964	hsa-miR-302f	CLIP-seq
MIRT1954965	hsa-miR-3160-5p	CLIP-seq
MIRT1954966	hsa-miR-3941	CLIP-seq
MIRT1954967	hsa-miR-4643	CLIP-seq
MIRT1954968	hsa-miR-466	CLIP-seq
MIRT1954969	hsa-miR-4672	CLIP-seq
MIRT1954970	hsa-miR-4789-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001878	Process	Response to yeast	IDA	18603306
GO:0001935	Process	Endothelial cell proliferation	IDA	17267696
GO:0001944	Process	Vasculature development	IDA	17267696
GO:0001976	Process	Nervous system process involved in regulation of systemic arterial blood pressure	IDA	10642343
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10882736
GO:0002548	Process	Monocyte chemotaxis	IDA	15248232
GO:0005102	Function	Signaling receptor binding	IDA	16014619
GO:0005179	Function	Hormone activity	IDA	33602864, 35324283, 38603770
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	9620797, 14722252, 17689535, 23597562, 30209400, 32296183, 33602864
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2408883
GO:0005615	Component	Extracellular space	IDA	2408883, 18057382
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	17267696
GO:0006468	Process	Protein phosphorylation	IDA	20596610
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	1326102
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384, 33602864, 35324283, 38603770
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11014233, 14722252
GO:0007190	Process	Activation of adenylate cyclase activity	IDA	10822112, 16014619
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	9685362
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	17983652
GO:0007267	Process	Cell-cell signaling	TAS	2408883
GO:0007566	Process	Embryo implantation	IDA	17983652
GO:0008217	Process	Regulation of blood pressure	NAS	1318039
GO:0010523	Process	Negative regulation of calcium ion transport into cytosol	IDA	16014619
GO:0019731	Process	Antibacterial humoral response	IDA	18603306
GO:0019732	Process	Antifungal humoral response	IDA	18603306
GO:0030424	Component	Axon	IEA
GO:0031623	Process	Receptor internalization	IDA	10882736
GO:0031716	Function	Calcitonin receptor binding	IBA
GO:0031716	Function	Calcitonin receptor binding	IPI	8078488, 8940110
GO:0032147	Process	Activation of protein kinase activity	IDA	17983652
GO:0032730	Process	Positive regulation of interleukin-1 alpha production	IDA	16904178
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	16904178
GO:0042311	Process	Vasodilation	IDA	3266556
GO:0042311	Process	Vasodilation	IEA
GO:0042802	Function	Identical protein binding	IPI	23395606
GO:0043025	Component	Neuronal cell body	IEA
GO:0043542	Process	Endothelial cell migration	IDA	17267696
GO:0044877	Function	Protein-containing complex binding	IDA	14722252
GO:0045087	Process	Innate immune response	IDA	18603306
GO:0045651	Process	Positive regulation of macrophage differentiation	IDA	10822112
GO:0045671	Process	Negative regulation of osteoclast differentiation	IDA	10822112
GO:0045776	Process	Negative regulation of blood pressure	IDA	10642343
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045779	Process	Negative regulation of bone resorption	IDA	10822112, 17241109
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11014233
GO:0045986	Process	Negative regulation of smooth muscle contraction	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	18603306
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	18603306
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	9685362
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	18603306
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0097646	Process	Calcitonin family receptor signaling pathway	IDA	35324283
GO:0097646	Process	Calcitonin family receptor signaling pathway	IDA	35324283
GO:0097646	Process	Calcitonin family receptor signaling pathway	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	38603770
GO:0150059	Process	Amylin receptor 1 signaling pathway	IDA	38603770
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:0150060	Process	Amylin receptor 2 signaling pathway	IDA	35324283
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	33602864
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	10882736, 33602864

Other IDs

• MIM: 114130
• HGNC: 1437
• e!Ensembl: ENSG00000110680

Protein

• UniProt ID: P01258
• Protein name: Calcitonin [Cleaved into: Calcitonin (CT); Katacalcin (Calcitonin carboxyl-terminal peptide) (CCP) (PDN-21)]
• Protein function: [Calcitonin]: Calcitonin is a peptide hormone that causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. Calcitonin function is mediated by the calcitonin re
• PDB: 2JXZ, 7TYH, 7TYO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00214	Calc_CGRP_IAPP	1 → 121	Calcitonin / CGRP / IAPP family	Family

• Sequence:

  MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ
  MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR
  DMSSDLERDHRPHVSMPQNAN

• Sequence length: 141
• UniProt ID: P06881
• Protein name: Calcitonin gene-related peptide 1 (CGRP1) (Alpha-type CGRP) (Calcitonin gene-related peptide I) (CGRP-I)
• Protein function: CGRP1/CALCA is a peptide hormone that induces vasodilation mediated by the CALCRL-RAMP1 receptor complex (PubMed:1318039, PubMed:33602864, PubMed:9620797). Dilates a variety of vessels including the coronary, cerebral and systemic vasculature. I
• PDB: 6E3Y, 7KNU, 9AUC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00214	Calc_CGRP_IAPP	1 → 124	Calcitonin / CGRP / IAPP family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in spinal cord. {ECO:0000269|PubMed:3492492}.
• Sequence:

  MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ
  MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG
  RRRRDLQA

• Sequence length: 128

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling
Vascular smooth muscle contraction

Reactome:

G alpha (s) signalling events
Calcitonin-like ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcitonin polymorphism	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMMON MIGRAINE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCALCEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE WITHOUT AURA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIGEMINAL NEURALGIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abdominal Migraine	Abdominal Migraine	CTD_human_DG	12574409, 17635592		★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	31728743		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	31728743		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	15251615		★☆☆☆☆ Found in Text Mining only
Acute Confusional Migraine	Confusional Migraine	CTD_human_DG	12574409, 17635592		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	2499457, 2721023		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	21423046, 7500648, 8426480		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11380396, 16712930, 21423046, 7769856, 9204977		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28679347, 29422392, 30370491, 30852771		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	14722226, 21507233, 23707988		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	2731168		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10522989, 15233556, 17100569, 19958926, 29408964, 30300539, 3485648, 3488930, 7267504, 7913021, 7915822, 8675603		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16712930, 21423046, 9204977		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	10526852		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17365031		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	28024929, 28283568		★☆☆☆☆ Found in Text Mining only
amyloidosis IX	Amyloidosis	Pubtator	19445625	Associate	★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31783126		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	30889580		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28971699, 31114482		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	37676055	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28971699, 31114482		★☆☆☆☆ Found in Text Mining only
Aortic Stenosis Supravalvular	Aortic stenosis	Pubtator	3164411	Associate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	30918467		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	27751171	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18789524, 29947020		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	25578529	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10555038, 39754737	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	20367884		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20933260, 25010197, 28931832		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	3496139	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	11357950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18299477, 28229359		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	39754737	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31619220		★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	2839410, 8518793		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10906733		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11317366, 9549251		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	31618650	Stimulate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	8947587, 8980249		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	2502220, 26895962, 26911465, 31701920	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28689769		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	7814611	Inhibit	★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	1052783, 760539		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1322087, 24853718, 29100335, 7619207, 8980249, 9164825, 9487987		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	6309149	Associate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	15127121, 16777450		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	31326577		★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	11250764, 115572, 12410354, 16736292, 20203154, 2311068, 24297502, 24449023, 2742487, 3731193, 3902867, 6472115, 7275099, 7491529, 7573303, 7829628, 7915822, 8094268, 9630179		★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	30570885	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid tumor of lung	Carcinoid Tumor Of Lung	BEFREE	29124912		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	1360888, 18626012, 23302073, 2731168		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	34234876	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1633879, 3488930, 6148938, 7690720, 9685226		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24980822	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21507233	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15880427, 21056906		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	11005710	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29689347, 30283343		★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	6293644, 6303368, 6686863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	30235108		★☆☆☆☆ Found in Text Mining only
Cerebral Vasospasm	Cerebral Vasospasm	BEFREE	23576867		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29201197, 30327930		★☆☆☆☆ Found in Text Mining only
Cervical Migraine Syndrome	Migraine	CTD_human_DG	12574409, 17635592		★☆☆☆☆ Found in Text Mining only
Cherubism	Cherubism	BEFREE	10193324		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	16712930, 21423046, 9204977		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	30700848		★☆☆☆☆ Found in Text Mining only
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Choreoathetosis	Pubtator	2408883	Associate	★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	1382027		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8426480		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	8309247		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28388301, 28672914		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	37126606	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27513455, 29478714		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	2731168		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	14722226	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	2731168		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	9365158		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14722226, 30999858, 9365158	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	CTD_human_DG	11304026, 14659530		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	BEFREE	25881990, 26994300		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	BEFREE	30720141		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31312143		★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	36111429	Associate	★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	35618042	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29878340		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22429353	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29878340		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	23832723	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29878340		★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	17251226	Stimulate	★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	15636430		★☆☆☆☆ Found in Text Mining only
Deafness Autosomal Dominant 1	Deafness	Pubtator	37400756	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	16690336		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19736013, 26400621, 27751171, 28431586, 28514714, 29748528		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	25269705		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28659833, 29878340, 30220332		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	37126606, 37676055	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37676055	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18211417		★☆☆☆☆ Found in Text Mining only
Developmental Dysplasia of the Hip	Developmental dysplasia of the hip	Pubtator	25578529	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12588889, 12594852, 28755389, 28850875, 29059473, 29201871, 29279300, 30140706		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12588889, 12594852, 28755389, 28850875, 29059473, 29201871, 29279300, 30140706		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22429353	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26895962, 26911465, 28614667	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12594852, 28652188		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	1587533, 28755389, 29501724, 3053705, 31848464		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	12594852		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	26579581, 29115286	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic neuropathy	Pubtator	34764216	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29115286	Associate	★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	27742787, 30215224		★☆☆☆☆ Found in Text Mining only
Disorders of Porphyrin Metabolism	Porphyria	BEFREE	2499457, 2721023		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	36298678	Associate	★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	30274796		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	CTD_human_DG	16289943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome, Partial Trisomy 21	Down Syndrome	CTD_human_DG	16289943		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	8980249		★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	38602109	Associate	★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	28387901		★☆☆☆☆ Found in Text Mining only
Endocrine Gland Neoplasms	Endocrine Gland Neoplasms	BEFREE	3112776		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	18248648		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30804432		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	33602248, 33934575	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	16825954		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	LHGDN	18779512		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30327930		★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic ataxia	Pubtator	32093657, 37221478	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17251226	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	30575958		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17485015, 18959118		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	30741933		★☆☆☆☆ Found in Text Mining only
Familial benign hypercalcemia	Hypocalciuric hypercalcemia	BEFREE	2028833		★☆☆☆☆ Found in Text Mining only
Familial Hemiplegic Migraine	Hemiplegic Migraine	BEFREE	18779512, 21457239		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	12437249, 12679485, 1411944, 16118333, 16205644, 17891246, 17931047, 18931957, 20878367, 21455198, 22965292, 2302785, 28166595, 28382288, 29239041, 30366876, 30903267, 3731193, 657681, 6648816, 7125737, 8099830		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29129515		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	18673438, 30700848		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	27729741	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	38233947	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	25027394		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	7769107		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	9094994	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29625448		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29263181		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29263181		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29263181		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16739344, 31619220		★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	22246026, 26990646, 29916084, 30409109, 33648385, 33981769, 35795317	Stimulate	★☆☆☆☆ Found in Text Mining only
Headache	Headache	Pubtator	34895133, 35162776, 40341526	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28572046		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	2346957	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	23832723	Inhibit	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31312143		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	8592060	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemicrania migraine	Hemicrania Migraine	CTD_human_DG	12574409, 17635592		★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	33981769	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	35795317	Associate	★☆☆☆☆ Found in Text Mining only
Hemiplegic migraine, familial type 1	Hemiplegic migraine	BEFREE	18779512		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	2839410		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	15740492		★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	30262140		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	23744765, 8675603		★☆☆☆☆ Found in Text Mining only
Humoral hypercalcemia of malignancy (disorder)	Humoral Hypercalcemia Of Malignancy	BEFREE	1938595		★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	31727331		★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	20433208	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperalgesia	Hyperalgesia	Pubtator	37815254	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	CTD_human_DG	1115441, 12637657		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	BEFREE	17188588, 1867260, 1938595, 2486208, 27620657, 29211870, 29480854, 29658374, 29915859, 30262523, 30280284, 30655691, 31088386, 8855805		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	Pubtator	7814611	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism	Hyperinsulinism	Pubtator	22281887	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30451912		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	1244790, 15251615		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	19958926, 31412223, 3902867, 8678955		★☆☆☆☆ Found in Text Mining only
Hyperphosphatasemia with bone disease	Hyperphosphatasemia With Bone Disease	BEFREE	24433001		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	8094268	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	1285370, 17380845, 40033803	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	23356193	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension Portal	Portal hypertension	Pubtator	24507687	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	10694533, 16909931, 17643632, 19462497, 20375903, 21269690, 24338417, 27614623, 28632750, 29297736, 30618546, 30818175		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	17485015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	1849535, 9887042		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	28121960		★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	Pubtator	37876543	Associate	★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	27715340		★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia	Hypocalciuric Hypercalcemia	BEFREE	2028833		★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia familial type 1	Hypocalciuric hypercalcemia	Pubtator	16491288	Associate	★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	BEFREE	10561095		★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	29383408		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	1376685	Stimulate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29266061		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29813107		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	3053705, 7923832		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	11357950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	24650225		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30717434	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	26446924	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28263849		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	17188588		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	31131225		★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	3485540		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31059106	Associate	★☆☆☆☆ Found in Text Mining only
Lesion of Sciatic Nerve	Lesion Of Sciatic Nerve	CTD_human_DG	19852068		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11245020, 7769856		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	3607279	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	21406719, 26720758	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1405705, 21423046, 2731168, 31756985, 3607279, 7500648, 7769856		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	30343334		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	38233947	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	1738589, 18626012, 2408883, 2639133, 30516882	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	2408883		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	3485540	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32141647, 34800986	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	3009002, 7769856		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28659833, 30509331, 7715797		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30777055		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	1322087, 24853718, 29100335, 8980249, 9164825, 9399657		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	14871811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	3009002, 6148938, 7690720, 9685226		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15880427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	23844610		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11476942, 11507054, 15929083, 16158948, 16222118, 16886606, 17487556, 18784182, 19001380, 26432469, 28428082, 31561211, 31619220		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16222118		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	15355445, 17891246, 27618325, 28092147, 28378396, 28911729		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10871866, 15880427, 22158037, 22922959, 26285815, 26479990, 27754959, 28581479, 28590120, 28981741, 29279300, 29319359, 29403290, 31010875, 31284812, 3607279, 7750484, 7769856		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	9549251		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	17115102, 28546130, 2948594, 31782260, 679097, 7725749		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	10327060, 10474127, 10561095, 10619409, 10803592, 10871866, 10951350, 11026573, 11174835, 1117836, 11181514, 11238493, 11289752, 11376404, 11392493, 11498767, 11502806, 11688458, 11720443, 11788662, 11900877, 11987030, 12063634, 12089863, 12205548, 12359227, 12480920, 12490846, 12679485, 12858002, 12869215, 1335241, 1359042, 1411944, 1455309, 14558925, 14668737, 14739494, 14870789, 14962731, 15168342, 15355445, 16118333, 16205644, 16356091, 16357561, 16739344, 16813623, 16955009, 17090547, 17115102, 17145757, 1745984, 1761559, 17639053, 17696833, 17891246, 17931047, 18174722, 1824340, 18299477, 18685492, 18948764, 18976013, 18987170, 19125012, 19281427, 19372564, 19488601, 19638924, 1969787, 19815051, 20027, 20212415, 20627492, 20729730, 2115330, 21272686, 2157143, 21711375, 22158037, 22162466, 22209341, 2229929, 2253409, 2269360, 22890595, 2300897, 2302785, 23059849, 23259706, 23676418, 23849459, 23861463, 2401708, 2408883, 2418963, 24357249, 24617864, 24629865, 24845513, 25231454, 25316501, 25319874, 25694125, 2574082, 25781697, 2582437, 26285815, 26481456, 26647152, 26992356, 27185870, 27400880, 27742787, 27754959, 27808486, 28024929, 28166595, 28429044, 28506418, 28546130, 28552629, 28562377, 28585679, 28614009, 28646462, 28683235, 28687633, 2868883, 28755389, 28821980, 28829399, 28843253, 28883261, 2890300, 28911154, 28911729, 28929017, 2894239, 28943896, 29063495, 29124912, 29169190, 29250686, 29284496, 29403290, 29408964, 2948594, 29501724, 29524315, 29635700, 29663329, 29707993, 29739896, 29766245, 29847167, 29895542, 29909163, 30051240, 30072486, 3011805, 30215224, 30229381, 3024119, 30300539, 30358622, 30366876, 30374431, 30415778, 30548085, 30552230, 30562193, 30574858, 30660595, 30684230, 30717909, 30725475, 30794525, 30829709, 30865531, 30903267, 31001799, 31010875, 3112776, 31142313, 31192146, 31192151, 31259158, 31273680, 31409511, 31483088, 31494787, 31530165, 31602360, 31619220, 31782260, 31841033, 3258183, 3467830, 3485540, 3485648, 3488930, 3490472, 3491070, 3855302, 3902867, 476574, 6148938, 6472115, 6546764, 6610687, 6648816, 6746863, 679097, 6883734, 6896146, 7099794, 7275099, 7573303, 7638742, 7666591, 7691931, 76933, 7725749, 7750101, 7904611, 7915822, 8050128, 8054788, 8094268, 8208368, 8265349, 8386116, 8433214, 8475796, 8563482, 8675603, 8745063, 8756555, 8949970, 9149305, 9167955, 950371, 9510122, 9606292, 9630179, 9660211, 9664907, 9681838, 9681853, 9705072, 9769122, 9769123, 9777749		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	19614683		★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	11357950		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28659833, 29878340, 30220332		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	11317366		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28666011		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	CTD_human_DG	12574409, 17635592		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	15014183, 16802852, 18437288, 18776915, 19770473, 19914210, 20433208, 23237777, 29471874, 29916084, 30006780, 31014225, 31159727, 32049005, 32238376, 32276265, 32647152, 33066724, 33141461, 33155547, 33626922, 33648385, 33818780, 33855218, 33934575, 34263680, 34424593, 34477213, 34521726, 34544359, 34580838, 34600468, 34625019, 34696711, 34759933, 34895054, 34895133, 34906111, 34922444, 35146696, 35162776, 35305579, 35505285, 35556143, 35575969, 35604755, 35620946, 35655137, 35698032, 35795317, 35796521, 35941572, 36089587, 36111429, 36115947, 36195452, 36205100, 36333710, 36350532, 36429413, 36430285, 36548744, 36792216, 36813730, 36855950, 37062749, 37072224, 37126606, 37221478, 37241168, 37268904, 37400756, 37523183, 37532991, 37540009, 37551544, 37580864, 37582724, 37679723, 37763679, 37899428, 38231270, 38231271, 38238659, 38262999, 38266060, 38284301, 38502425, 38518587, 38583127, 38602109, 39266962, 39459471, 39481344, 39497430, 39654467, 39754737, 40033803, 40239029, 40267275, 40341526, 40384614, 40442685, 40461909, 40501126, 40670062	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	LHGDN	17123735, 18779512		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	BEFREE	17141570, 17257240, 17344407, 18779512, 19607849, 20188075, 20959432, 21040789, 21195698, 21457239, 22074408, 22123247, 23237777, 23917876, 25340934, 26501962, 26728923, 26751129, 26951335, 26994300, 27465216, 27687880, 27884929, 27919019, 27919795, 27940880, 28053042, 28129635, 28165287, 28179394, 28192258, 28215304, 28233915, 28234796, 28240610, 28260603, 28270183, 28301400, 28321564, 28376659, 28389966, 28409893, 28460892, 28485842, 28488307, 28496430, 28527063, 28572046, 28584969, 28616038, 28642283, 28644160, 28653227, 28707585, 28822016, 28856479, 28856910, 28884307, 28972120, 29020807, 29082826, 29089894, 29116598, 29136283, 29171818, 29209105, 29237283, 29255900, 29260608, 29297736, 29310444, 29335794, 29344989, 29350588, 29352859, 29396834, 29406534, 29411638, 29471679, 29532195, 29556965, 29566540, 29616494, 29616830, 29623520, 29654418, 29691490, 29695168, 29697153, 29697156, 29869205, 29904827, 29915934, 29932027, 29968151, 29976087, 29987329, 29994995, 30003352, 30086681, 30127722, 30182284, 30187471, 30189270, 30220332, 30242830, 30311143, 30377783, 30392545, 30403405, 30406901, 30413151, 30417776, 30450545, 30502971, 30522135, 30527443, 30550780, 30600979, 30643015, 30648737, 30651064, 30656853, 30661365, 30681821, 30681822, 30717631, 30799680, 30813769, 30866804, 30874961, 30917684, 30950844, 30962278, 30977520, 30982963, 30989485, 31020659, 31024319, 31039731, 31043094, 31043785, 31060490, 31070784, 31081399, 31085251, 31101004, 31104506, 31109209, 31122188, 31127003, 31150417, 31159727, 31177856, 31181379, 31208068, 31220963, 31234642, 31253091, 31284729, 31288556, 31291018, 31291516, 31311674, 31326215, 31327684, 31328279, 31354502, 31366221, 31375062, 31418911, 31470791, 31475573, 31482569, 31537107, 31547694, 31550937, 31556018, 31559638, 31589869, 31603037, 31640402, 31668411, 31674221, 31675102, 31684759, 31686900, 31707815, 31710104, 31714319, 31718551, 31742631, 31752521, 31756985, 31781974, 31828875		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	19277835, 26990646, 29987329, 30409109, 33981769, 35895308, 36253732, 37815254	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine Disorders	Migraine	Pubtator	32620151, 35687795, 35876297, 36648736, 37231663, 37264889, 37776119, 38615937, 40094594, 40152794, 40501125, 40528434	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine with Aura	BEFREE	28642283, 29722303		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	32093657	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	37679723	Stimulate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	37815254	Inhibit	★☆☆☆☆ Found in Text Mining only
Milk-Alkali Syndrome	Milk-Alkali Syndrome	CTD_human_DG	1115441, 12637657		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17572454		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	28898282, 33602248	Associate	★☆☆☆☆ Found in Text Mining only
Multinodular goiter	Multinodular goiter	BEFREE	11502806, 20013610, 31619220		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	16205644, 18976013, 22890595, 29239041, 6546764		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	10474127, 12679485, 16356097, 2574082, 29484475, 3485648, 476574, 7267504		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	10474127, 12437249, 12679485, 1359042, 15233556, 16356097, 17704047, 2574082, 27400880, 2894239, 30072953, 30374431, 3485648, 476574, 7267504, 7638742, 7915822, 8094268, 9086571, 950371		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2b	Multiple Endocrine Neoplasia	BEFREE	10871866		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35204700	Associate	★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	23665165	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	2450175	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	9973484		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11245020, 16890288, 7500648, 8426480		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	16890288		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	2039824, 8309247, 8426480, 8947587, 8980249		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	8309247		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	33141461	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29878340		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	34388069	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20473931		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20473931	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	7666591		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	35505285	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10327060, 10522989, 10870026, 1111937, 11376404, 11407657, 11498767, 12192544, 12354139, 12437249, 12478492, 1455309, 14759564, 15345114, 1575215, 17188588, 17380445, 1745984, 17487556, 17931047, 19281427, 1928560, 1938595, 20351352, 21190982, 2157143, 22345297, 2253409, 2300897, 23676418, 23979292, 24449826, 24882762, 2555054, 2557987, 2565762, 25694125, 2574082, 27185870, 2731109, 2731168, 27618325, 27922893, 28562377, 2856898, 28881587, 28911154, 29025983, 29063495, 29100335, 29169190, 29263181, 29279300, 29484475, 29847167, 29909163, 3024119, 30262140, 30574858, 30800639, 31001799, 3112776, 31192151, 31259158, 31273680, 31483088, 31549322, 3345727, 3485648, 3607279, 3855302, 3967626, 657681, 76933, 7725749, 8276566, 8428296, 8544456, 8636377, 8678955, 8783101, 8980249, 9149305, 9167955, 9174630, 9255265, 9365158, 9510122, 9664907		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	9365158		★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	BEFREE	2168411		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21195698, 30502971		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	31192146		★☆☆☆☆ Found in Text Mining only
Neuralgia-Neuritis, Sciatic Nerve	Sciatic Nerve Neuralgia-Neuritis	CTD_human_DG	19852068		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	1322087, 17313453		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	9303556	Associate	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19372564, 28687633, 29124912, 31283604, 31619220		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	20720158		★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	15531548, 23295290		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29464178		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11895880, 2557987		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	18626012		★☆☆☆☆ Found in Text Mining only
Nonmedullary Thyroid Carcinoma	Nonmedullary thyroid carcinoma	BEFREE	18931957, 28821980		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21106708, 22960196, 29201871		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26911465	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	30540227, 31692350		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	27751171, 28431586, 30205824, 37657066	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	27387445		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	17009253, 28431586, 28546767, 30205824, 30240937		★☆☆☆☆ Found in Text Mining only
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	16690336		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	1963534, 19946674, 2502220, 27578548, 28652188, 9668556		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	10737755, 17026622, 2502220, 27909823, 28131131, 28220476, 28514714, 28689769, 28726540, 28739873, 28981741, 29083977, 29462059, 29745315, 29869573, 30305826, 30540227, 30655691, 30729223, 30888309, 31041475, 31054990, 31079501, 31121190, 31504411, 31692350, 9072932, 9817931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	2502220, 28614667, 31701920	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	37354016	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	10737755, 30797058, 3549095		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10209067, 9383685		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	9383685	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15880427		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15880427		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21056906	Associate	★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	30540227		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	18953261		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31109903		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	12410354		★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	30838545		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	22209341, 25595276		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11317366, 21195698, 28659833		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29978492		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	18928847	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	29107933, 31423894		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	30152246	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	2428885	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10522989, 15233556, 17100569, 19958926, 29408964, 30300539, 3485648, 3488930, 7267504, 7913021, 7915822, 8675603		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27895088		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35551681	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16712930		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	16712930		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	19946674		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	11357950		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11476942, 11507054, 15929083, 16158948, 16222118, 16886606, 17487556, 18784182, 19001380, 31561211, 31619220		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11240828, 12506413, 16222118, 16886606, 18793421, 23820954, 36799165	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16222118, 17487556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16222118		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16574742, 18784182		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19001380	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pruritus	Pruritus	Pubtator	36272417	Associate	★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	BEFREE	11443172, 29087612		★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism, Type Ia	Pseudohypoparathyroidism	BEFREE	11443172		★☆☆☆☆ Found in Text Mining only
Pseudopseudohypoparathyroidism	Pseudopseudohypoparathyroidism	BEFREE	11443172		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11776062, 25997247, 30893385		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	37681909	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	25997247		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	38233947	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17365031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Raynaud Disease	Raynaud disease	Pubtator	1931469, 35505285, 8046721	Associate	★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	38302542	Stimulate	★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	29698501, 31310337		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	14871811		★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	28679347, 29384906		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	39972460	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	30980517	Associate	★☆☆☆☆ Found in Text Mining only
Rosacea	Rosacea	Pubtator	38630457	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	34981273	Associate	★☆☆☆☆ Found in Text Mining only
Sciatic Nerve Palsy	Sciatic Nerve Palsy	CTD_human_DG	19852068		★☆☆☆☆ Found in Text Mining only
Sciatic Neuritis	Sciatic Neuritis	CTD_human_DG	19852068		★☆☆☆☆ Found in Text Mining only
Sciatic Neuropathy	Sciatic Neuropathy	CTD_human_DG	19852068		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	38233947	Stimulate	★☆☆☆☆ Found in Text Mining only
Secondary Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	40398661	Inhibit	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	10402059, 10984072, 12960010, 15286549, 23799041, 24135723, 26339334, 26476896, 28079172, 28387901, 28962140, 29465314, 29968788, 30024613, 30116318, 30132205, 30142533, 30547887, 31003186, 31284812, 31574301		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency disease	BEFREE	23280131		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	31423894		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11895880, 2157143, 2544624, 3030544, 8019984, 8111580		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of ovary	Ovarian Carcinoma	BEFREE	1331173		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	2157143, 2544624	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23707988		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34800986	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30327930		★☆☆☆☆ Found in Text Mining only
Status Migrainosus	Status Migrainosus	CTD_human_DG	12574409, 17635592		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	32581184	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	23576867, 28790969, 30653947, 31401069		★☆☆☆☆ Found in Text Mining only
Supravalvular aortic stenosis	Supravalvar aortic stenosis	BEFREE	3164411		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29952300		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	30465456		★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	28670360		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28881587		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	37508506	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	9973484		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	12480920, 12560396, 1335241, 1376685, 15572361, 17090547, 1761559, 18626012, 20664475, 2157143, 23259706, 2428885, 25694125, 2576941, 2639133, 26884307, 26992356, 27097545, 28883261, 28911154, 2985435, 3011805, 31841033, 32141647, 32242507, 33485291, 3490472, 3491070, 3492492, 35280443, 3855302, 3872459, 39842635, 6896146, 7915822, 8094268, 8265349, 8816445	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	19488601, 23214280, 2408883, 2576946	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	15355445, 17891246, 18626012, 2335800, 2408883, 24629865, 27618325, 28092147, 28378396, 28546130, 28911729, 30702570, 3485648, 8157713, 8433214		★☆☆☆☆ Found in Text Mining only
THYROID CARCINOMA, SPORADIC MEDULLARY	Thyroid Carcinoma	BEFREE	18331611, 28166595, 30903267		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	1376685	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	16356091, 30794525, 8157713, 9630179		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Oncocytic Adenoma	Thyroid Gland Oncocytic Adenoma	BEFREE	31727331		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10489126, 11022174, 19488601, 27618325, 28092147, 28378396, 28929017		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	2269360, 35280443	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	10474127, 11407657, 16356091, 16357561, 18299477, 19125012, 19488601, 22068382, 25231454, 25319874, 26481456, 26695504, 28092147, 28166595, 28755389, 29124912, 29635700, 30358622, 30518486, 30597074		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	CTD_human_DG	27093858		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	30334198		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trigeminal Neuralgia, Idiopathic	Trigeminal neuralgia	CTD_human_DG	27093858		★☆☆☆☆ Found in Text Mining only
Trisomy 21, Meiotic Nondisjunction	Trisomy 21	CTD_human_DG	16289943		★☆☆☆☆ Found in Text Mining only
Trisomy 21, Mitotic Nondisjunction	Trisomy 21	CTD_human_DG	16289943		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19617644, 23010746		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	28659833, 7715797		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18843024	Associate	★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	11464063		★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	28566000, 29650024		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23356193	Associate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	40442685	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	29383408		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	8772572		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	20729730		★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	1867260, 2486208, 3164411		★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams syndrome	Pubtator	3164411	Associate	★☆☆☆☆ Found in Text Mining only