Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79589
Gene name	Ring finger protein 128
Gene symbol	RNF128
Synonyms (NCBI Gene)	GRAIL
Chromosome	X
Chromosome location	Xq22.3
Summary	The protein encoded by this gene is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of this gene in retrovirally

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021799	hsa-miR-132-3p	Microarray	17612493
MIRT025823	hsa-miR-7-5p	Microarray	17612493
MIRT048992	hsa-miR-92a-3p	CLASH	23622248
MIRT663819	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT663818	hsa-miR-619-3p	HITS-CLIP	23824327
MIRT663817	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT663816	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT663815	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT663814	hsa-miR-1248	HITS-CLIP	23824327
MIRT663813	hsa-miR-6128	HITS-CLIP	23824327
MIRT663812	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT663811	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT663810	hsa-miR-607	HITS-CLIP	23824327
MIRT663809	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT663808	hsa-miR-1305	HITS-CLIP	23824327
MIRT663807	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT663819	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT663818	hsa-miR-619-3p	HITS-CLIP	23824327
MIRT663817	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT663816	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT663815	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT663814	hsa-miR-1248	HITS-CLIP	23824327
MIRT663813	hsa-miR-6128	HITS-CLIP	23824327
MIRT663812	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT663811	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT663810	hsa-miR-607	HITS-CLIP	23824327
MIRT663809	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT663808	hsa-miR-1305	HITS-CLIP	23824327
MIRT663807	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT1309904	hsa-miR-129-5p	CLIP-seq
MIRT1309905	hsa-miR-619	CLIP-seq
MIRT1309906	hsa-miR-3121-3p	CLIP-seq
MIRT1309907	hsa-miR-3140-3p	CLIP-seq
MIRT1309908	hsa-miR-33a	CLIP-seq
MIRT1309909	hsa-miR-33b	CLIP-seq
MIRT1309910	hsa-miR-498	CLIP-seq
MIRT2393811	hsa-miR-124	CLIP-seq
MIRT2393812	hsa-miR-3714	CLIP-seq
MIRT2393813	hsa-miR-3910	CLIP-seq
MIRT2393814	hsa-miR-4477a	CLIP-seq
MIRT2393815	hsa-miR-506	CLIP-seq
MIRT1309905	hsa-miR-619	CLIP-seq
MIRT2393816	hsa-miR-656	CLIP-seq
MIRT2458345	hsa-miR-4254	CLIP-seq
MIRT2458346	hsa-miR-4434	CLIP-seq
MIRT2458347	hsa-miR-4516	CLIP-seq
MIRT2458348	hsa-miR-4531	CLIP-seq
MIRT2458349	hsa-miR-4732-3p	CLIP-seq
MIRT2458350	hsa-miR-548ac	CLIP-seq
MIRT2458351	hsa-miR-548d-3p	CLIP-seq
MIRT2458352	hsa-miR-548z	CLIP-seq
MIRT1309905	hsa-miR-619	CLIP-seq
MIRT2458353	hsa-miR-642b	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005770	Component	Late endosome	IBA
GO:0005770	Component	Late endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	25635054
GO:0008270	Function	Zinc ion binding	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031647	Process	Regulation of protein stability	IMP	25635054
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0061462	Process	Protein localization to lysosome	IC	25635054
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	TAS	25635054
GO:1904352	Process	Positive regulation of protein catabolic process in the vacuole	IC	25635054

MIM	HGNC	e!Ensembl
300439	21153	ENSG00000133135

Q8TEB7

Protein name

E3 ubiquitin-protein ligase RNF128 (EC 2.3.2.27) (Gene related to anergy in lymphocytes protein) (GRAIL) (RING finger protein 128) (RING-type E3 ubiquitin transferase RNF128)

Protein function

E3 ubiquitin-protein ligase that catalyzes 'Lys-27', 'Lys-48'- or 'Lys-63'-linked polyubiquitin chains formation and plays a role in different biological processes such as modulation of immune response, cytoskeletal dynamics or protein homeostas

PDB

3ICU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02225	PA	80 → 179	PA domain	Family
PF13639	zf-RING_2	275 → 318	Ring finger domain	Domain

Sequence

MGPPPGAGVSCRGGCGFSRLLAWCFLLALSPQAPGSRGAEAVWTAYLNVSWRVPHTGVNR
TVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALI
QRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKIL
QSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYSARRLRNARAQ
SRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDLVRILTCNHIFH
KTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSE
TASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQE
TAVREIKS

Sequence length

428

Interactions

View interactions

	Reactome
			Ub-specific processing proteases Ovarian tumor domain proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RNF128-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Barrett Esophagus	Barrett esophagus	BEFREE	31715145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	34416429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31715145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	25108383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37186218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25351606		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30832692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31715145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	25108383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36503162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31216681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	18467499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33962392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF128 (ring finger protein 128)