Gene Gene information from NCBI Gene database.
Entrez ID 79587
Gene name Cysteinyl-tRNA synthetase 2, mitochondrial
Gene symbol CARS2
Synonyms (NCBI Gene)
COXPD27cysRS
Chromosome 13
Chromosome location 13q34
Summary This gene encodes a putative member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is like
SNPs SNP information provided by dbSNP.
6
SNP ID Visualize variation Clinical significance Consequence
rs557671802 G>A Pathogenic Non coding transcript variant, missense variant, 5 prime UTR variant, coding sequence variant
rs727505361 C>T Likely-pathogenic, pathogenic Missense variant, 5 prime UTR variant, non coding transcript variant, coding sequence variant
rs753472937 CTC>- Pathogenic 5 prime UTR variant, inframe deletion, non coding transcript variant, coding sequence variant
rs1258446331 AA>- Likely-pathogenic Non coding transcript variant, frameshift variant, coding sequence variant
rs1412483498 G>- Likely-pathogenic Frameshift variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant, intron variant, upstream transcript variant, 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
3
miRTarBase ID miRNA Experiments Reference
MIRT020814 hsa-miR-155-5p Proteomics 18668040
MIRT029604 hsa-miR-26b-5p Microarray 19088304
MIRT047820 hsa-miR-30d-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004812 Function Aminoacyl-tRNA ligase activity IEA
GO:0004817 Function Cysteine-tRNA ligase activity IBA
GO:0004817 Function Cysteine-tRNA ligase activity IEA
GO:0004817 Function Cysteine-tRNA ligase activity IMP 29079736
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612800 25695 ENSG00000134905
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HA77
Protein name Probable cysteine--tRNA ligase, mitochondrial (EC 6.1.1.16) (Cysteinyl-tRNA synthetase) (CysRS)
Protein function Mitochondrial cysteine-specific aminoacyl-tRNA synthetase that catalyzes the ATP-dependent ligation of cysteine to tRNA(Cys). ; In addition to its role as an aminoacyl-tRNA synthetase, has also cysteine pe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01406 tRNA-synt_1e 65 365 tRNA synthetases class I (C) catalytic domain Family
Sequence
MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTG
RKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITD
VDDKIIKRANEMNISPASLASLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGII
ARGNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALWKAAKPQEV
FWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWG
NYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAM
LQAQQ
LLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVV
DAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSE
ATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINI
KDRSSTTSTWELLDQRTKDQKSAG
Sequence length 564
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Aminoacyl-tRNA biosynthesis  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Combined oxidative phosphorylation defect type 27 Pathogenic; Likely pathogenic rs1555342802, rs1887501594 RCV001199369
RCV001249205
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BONE REMODELING DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARS2-related disorder Conflicting classifications of pathogenicity; Likely benign; Benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 31724540
★☆☆☆☆
Found in Text Mining only
Autistic behavior Autism HPO_DG
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 31724540
★☆☆☆☆
Found in Text Mining only
Cerebellar Hypoplasia Cerebellar Hypoplasia HPO_DG
★☆☆☆☆
Found in Text Mining only
Cerebral atrophy Cerebral Atrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 36299603 Associate
★☆☆☆☆
Found in Text Mining only
Combined oxidative phosphorylation defect type 27 Combined Oxidative Phosphorylation Deficiency Orphanet
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 27 Combined Oxidative Phosphorylation Deficiency UNIPROT_DG 25361775, 25787132
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 27 Combined Oxidative Phosphorylation Deficiency ORPHANET_DG 25361775, 25787132
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 27 Combined Oxidative Phosphorylation Deficiency GENOMICS_ENGLAND_DG 25787132, 30139652
★★☆☆☆
Found in Text Mining + Unknown/Other Associations