Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79586
Gene name	Chondroitin polymerizing factor
Gene symbol	CHPF
Synonyms (NCBI Gene)	CHPF1CHSY2CSS2
Chromosome	2
Chromosome location	2q35

166

Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019908	hsa-miR-375	Microarray	20215506
MIRT029890	hsa-miR-26b-5p	Microarray	19088304
MIRT046494	hsa-miR-15b-5p	CLASH	23622248
MIRT891344	hsa-miR-1207-5p	CLIP-seq
MIRT891345	hsa-miR-1275	CLIP-seq
MIRT891346	hsa-miR-214	CLIP-seq
MIRT891347	hsa-miR-3122	CLIP-seq
MIRT891348	hsa-miR-3175	CLIP-seq
MIRT891349	hsa-miR-3187-3p	CLIP-seq
MIRT891350	hsa-miR-342-5p	CLIP-seq
MIRT891351	hsa-miR-3612	CLIP-seq
MIRT891352	hsa-miR-3619-5p	CLIP-seq
MIRT891353	hsa-miR-3689a-3p	CLIP-seq
MIRT891354	hsa-miR-3689c	CLIP-seq
MIRT891355	hsa-miR-3913-5p	CLIP-seq
MIRT891356	hsa-miR-4259	CLIP-seq
MIRT891357	hsa-miR-4260	CLIP-seq
MIRT891358	hsa-miR-4291	CLIP-seq
MIRT891359	hsa-miR-4313	CLIP-seq
MIRT891360	hsa-miR-4425	CLIP-seq
MIRT891361	hsa-miR-4434	CLIP-seq
MIRT891362	hsa-miR-4443	CLIP-seq
MIRT891363	hsa-miR-4455	CLIP-seq
MIRT891364	hsa-miR-450b-3p	CLIP-seq
MIRT891365	hsa-miR-4516	CLIP-seq
MIRT891366	hsa-miR-4525	CLIP-seq
MIRT891367	hsa-miR-4529-5p	CLIP-seq
MIRT891368	hsa-miR-4651	CLIP-seq
MIRT891369	hsa-miR-4664-5p	CLIP-seq
MIRT891370	hsa-miR-4665-5p	CLIP-seq
MIRT891371	hsa-miR-4708-5p	CLIP-seq
MIRT891372	hsa-miR-4717-5p	CLIP-seq
MIRT891373	hsa-miR-4723-5p	CLIP-seq
MIRT891374	hsa-miR-4738-3p	CLIP-seq
MIRT891375	hsa-miR-4763-3p	CLIP-seq
MIRT891376	hsa-miR-4795-5p	CLIP-seq
MIRT891377	hsa-miR-486-3p	CLIP-seq
MIRT891378	hsa-miR-503	CLIP-seq
MIRT891379	hsa-miR-608	CLIP-seq
MIRT891380	hsa-miR-625	CLIP-seq
MIRT891381	hsa-miR-629	CLIP-seq
MIRT891382	hsa-miR-644	CLIP-seq
MIRT891383	hsa-miR-650	CLIP-seq
MIRT891384	hsa-miR-663b	CLIP-seq
MIRT891385	hsa-miR-761	CLIP-seq
MIRT891386	hsa-miR-769-3p	CLIP-seq
MIRT891387	hsa-miR-922	CLIP-seq
MIRT891344	hsa-miR-1207-5p	CLIP-seq
MIRT891388	hsa-miR-1253	CLIP-seq
MIRT891389	hsa-miR-1255a	CLIP-seq
MIRT891390	hsa-miR-1255b	CLIP-seq
MIRT891345	hsa-miR-1275	CLIP-seq
MIRT891391	hsa-miR-1293	CLIP-seq
MIRT891392	hsa-miR-1825	CLIP-seq
MIRT891393	hsa-miR-1915	CLIP-seq
MIRT891394	hsa-miR-198	CLIP-seq
MIRT891347	hsa-miR-3122	CLIP-seq
MIRT891395	hsa-miR-3144-5p	CLIP-seq
MIRT891348	hsa-miR-3175	CLIP-seq
MIRT891396	hsa-miR-326	CLIP-seq
MIRT891397	hsa-miR-330-5p	CLIP-seq
MIRT891350	hsa-miR-342-5p	CLIP-seq
MIRT891398	hsa-miR-361-3p	CLIP-seq
MIRT891355	hsa-miR-3913-5p	CLIP-seq
MIRT891357	hsa-miR-4260	CLIP-seq
MIRT891361	hsa-miR-4434	CLIP-seq
MIRT891399	hsa-miR-4483	CLIP-seq
MIRT891400	hsa-miR-4488	CLIP-seq
MIRT891364	hsa-miR-450b-3p	CLIP-seq
MIRT891365	hsa-miR-4516	CLIP-seq
MIRT891366	hsa-miR-4525	CLIP-seq
MIRT891401	hsa-miR-4640-5p	CLIP-seq
MIRT891368	hsa-miR-4651	CLIP-seq
MIRT891369	hsa-miR-4664-5p	CLIP-seq
MIRT891370	hsa-miR-4665-5p	CLIP-seq
MIRT891402	hsa-miR-4667-5p	CLIP-seq
MIRT891403	hsa-miR-4697-5p	CLIP-seq
MIRT891404	hsa-miR-4700-5p	CLIP-seq
MIRT891373	hsa-miR-4723-5p	CLIP-seq
MIRT891405	hsa-miR-4726-5p	CLIP-seq
MIRT891374	hsa-miR-4738-3p	CLIP-seq
MIRT891375	hsa-miR-4763-3p	CLIP-seq
MIRT891376	hsa-miR-4795-5p	CLIP-seq
MIRT891377	hsa-miR-486-3p	CLIP-seq
MIRT891406	hsa-miR-520a-5p	CLIP-seq
MIRT891407	hsa-miR-520f	CLIP-seq
MIRT891408	hsa-miR-525-5p	CLIP-seq
MIRT891379	hsa-miR-608	CLIP-seq
MIRT891380	hsa-miR-625	CLIP-seq
MIRT891381	hsa-miR-629	CLIP-seq
MIRT891409	hsa-miR-636	CLIP-seq
MIRT891410	hsa-miR-637	CLIP-seq
MIRT891411	hsa-miR-711	CLIP-seq
MIRT891412	hsa-miR-760	CLIP-seq
MIRT891386	hsa-miR-769-3p	CLIP-seq
MIRT891344	hsa-miR-1207-5p	CLIP-seq
MIRT891346	hsa-miR-214	CLIP-seq
MIRT891347	hsa-miR-3122	CLIP-seq
MIRT891349	hsa-miR-3187-3p	CLIP-seq
MIRT891351	hsa-miR-3612	CLIP-seq
MIRT1964200	hsa-miR-3614-5p	CLIP-seq
MIRT891352	hsa-miR-3619-5p	CLIP-seq
MIRT1964201	hsa-miR-3665	CLIP-seq
MIRT1964202	hsa-miR-3714	CLIP-seq
MIRT891355	hsa-miR-3913-5p	CLIP-seq
MIRT1964203	hsa-miR-4270	CLIP-seq
MIRT891358	hsa-miR-4291	CLIP-seq
MIRT1964204	hsa-miR-4300	CLIP-seq
MIRT891361	hsa-miR-4434	CLIP-seq
MIRT1964205	hsa-miR-4435	CLIP-seq
MIRT1964206	hsa-miR-4441	CLIP-seq
MIRT891362	hsa-miR-4443	CLIP-seq
MIRT1964207	hsa-miR-4477a	CLIP-seq
MIRT1964208	hsa-miR-4484	CLIP-seq
MIRT891364	hsa-miR-450b-3p	CLIP-seq
MIRT891365	hsa-miR-4516	CLIP-seq
MIRT1964209	hsa-miR-4701-5p	CLIP-seq
MIRT891372	hsa-miR-4717-5p	CLIP-seq
MIRT1964210	hsa-miR-4736	CLIP-seq
MIRT891374	hsa-miR-4738-3p	CLIP-seq
MIRT891375	hsa-miR-4763-3p	CLIP-seq
MIRT1964211	hsa-miR-485-5p	CLIP-seq
MIRT891377	hsa-miR-486-3p	CLIP-seq
MIRT891378	hsa-miR-503	CLIP-seq
MIRT1964212	hsa-miR-548an	CLIP-seq
MIRT1964213	hsa-miR-548s	CLIP-seq
MIRT1964214	hsa-miR-588	CLIP-seq
MIRT891381	hsa-miR-629	CLIP-seq
MIRT891383	hsa-miR-650	CLIP-seq
MIRT891412	hsa-miR-760	CLIP-seq
MIRT891385	hsa-miR-761	CLIP-seq
MIRT891386	hsa-miR-769-3p	CLIP-seq
MIRT1964215	hsa-miR-920	CLIP-seq
MIRT891387	hsa-miR-922	CLIP-seq
MIRT1964216	hsa-miR-940	CLIP-seq
MIRT891344	hsa-miR-1207-5p	CLIP-seq
MIRT891389	hsa-miR-1255a	CLIP-seq
MIRT891390	hsa-miR-1255b	CLIP-seq
MIRT891392	hsa-miR-1825	CLIP-seq
MIRT891394	hsa-miR-198	CLIP-seq
MIRT891346	hsa-miR-214	CLIP-seq
MIRT891347	hsa-miR-3122	CLIP-seq
MIRT891398	hsa-miR-361-3p	CLIP-seq
MIRT891352	hsa-miR-3619-5p	CLIP-seq
MIRT891355	hsa-miR-3913-5p	CLIP-seq
MIRT891358	hsa-miR-4291	CLIP-seq
MIRT891364	hsa-miR-450b-3p	CLIP-seq
MIRT891374	hsa-miR-4738-3p	CLIP-seq
MIRT891375	hsa-miR-4763-3p	CLIP-seq
MIRT891377	hsa-miR-486-3p	CLIP-seq
MIRT891378	hsa-miR-503	CLIP-seq
MIRT891406	hsa-miR-520a-5p	CLIP-seq
MIRT891407	hsa-miR-520f	CLIP-seq
MIRT891408	hsa-miR-525-5p	CLIP-seq
MIRT891381	hsa-miR-629	CLIP-seq
MIRT891409	hsa-miR-636	CLIP-seq
MIRT891385	hsa-miR-761	CLIP-seq
MIRT891386	hsa-miR-769-3p	CLIP-seq
MIRT891387	hsa-miR-922	CLIP-seq
MIRT891349	hsa-miR-3187-3p	CLIP-seq
MIRT1964200	hsa-miR-3614-5p	CLIP-seq
MIRT1964205	hsa-miR-4435	CLIP-seq
MIRT1964207	hsa-miR-4477a	CLIP-seq
MIRT1964209	hsa-miR-4701-5p	CLIP-seq
MIRT1964213	hsa-miR-548s	CLIP-seq
MIRT1964214	hsa-miR-588	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005515	Function	Protein binding	IPI	22082830
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0008376	Function	Acetylgalactosaminyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0032580	Component	Golgi cisterna membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0047238	Function	Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity	IBA
GO:0047238	Function	Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity	IDA	12761225
GO:0047238	Function	Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity	IEA
GO:0047238	Function	Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity	TAS
GO:0050510	Function	N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity	IDA	12761225
GO:0050510	Function	N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity	IEA
GO:0050510	Function	N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity	TAS
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IBA
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IDA	12716890, 12761225
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IEA
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	TAS

MIM	HGNC	e!Ensembl
610405	24291	ENSG00000123989

Q8IZ52

Protein name

Chondroitin sulfate synthase 2 (EC 2.4.1.175) (EC 2.4.1.226) (Chondroitin glucuronyltransferase 2) (Chondroitin-polymerizing factor) (ChPF) (Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II) (N-acetylgalactosami

Protein function

Has both beta-1,3-glucuronic acid and beta-1,4-N-acetylgalactosamine transferase activity. Transfers glucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of the elongating chondroitin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05679	CHGN	262 → 762	Chondroitin N-acetylgalactosaminyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in pancreas, ovary, brain, heart, skeletal muscle, colon, kidney, liver, stomach, spleen and placenta. {ECO:0000269|PubMed:12716890, ECO:0000269|PubMed:12761225}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed

Sequence

MRASLLLSVLRPAGPVAVGISLGFTLSLLSVTWVEEPCGPGPPQPGDSELPPRGNTNAAR
RPNSVQPGAEREKPGAGEGAGENWEPRVLPYHPAQPGQAAKKAVRTRYISTELGIRQRLL
VAVLTSQTTLPTLGVAVNRTLGHRLERVVFLTGARGRRAPPGMAVVTLGEERPIGHLHLA
LRHLLEQHGDDFDWFFLVPDTTYTEAHGLARLTGHLSLASAAHLYLGRPQDFIGGEPTPG
RYCHGGFGVLLSRMLLQQLRPHLEGCRNDIVSARPDEWLGRCILDATGVGCTGDHEGVHY
SHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFARAELERTYQEIQELQWEIQ
NTSHLAVDGDQAAAWPVGIPAPSRPASRFEVLRWDYFTEQHAFSCADGSPRCPLRGADRA
DVADVLGTALEELNRRYHPALRLQKQQLVNGYRRFDPARGMEYTLDLQLEALTPQGGRRP
LTRRVQLLRPLSRVEILPVPYVTEASRLTVLLPLAAAERDLAPGFLEAFATAALEPGDAA
AALTLLLLYEPRQAQRVAHADVFAPVKAHVAELERRFPGARVPWLSVQTAAPSPLRLMDL
LSKKHPLDTLFLLAGPDTVLTPDFLNRCRMHAISGWQAFFPMHFQAFHPAVAPPQGPGPP
ELGRDTGRFDRQAASEACFYNSDYVAARGRLAAASEQEEELLESLDVYELFLHFSSLHVL
RAVEPALLQRYRAQTCSARLSEDLYHRCLQSVLEGLGSRTQLAMLLFEQEQGNST

Sequence length

775

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate Metabolic pathways		Chondroitin sulfate biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30826152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	21468578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32612115	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33301643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34564711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30980258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30096295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36930359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	27690330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40348204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28627702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37851364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	25744272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35885984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21990321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31076460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32612115	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30980258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31118773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	40321814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34564711	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33545950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHPF (chondroitin polymerizing factor)