FYCO1 (FYVE and coiled-coil domain autophagy adaptor 1)

Gene

• Entrez ID: 79443
• Gene name: FYVE and coiled-coil domain autophagy adaptor 1
• Gene symbol: FYCO1
• Synonyms (NCBI Gene): CATC2, CTRCT18, RUFY3, ZFYVE7
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The gene encodes a Rab7 adapter protein that is implicated in the microtubule transport of autophagosomes. The encoded protein contains a RUN domain, a FYVE-type zinc finger domain, and Golgi dynamics (GOLD) domain. The encoded protein plays a role in mic

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs140159323	C>T	Pathogenic	Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
rs141476300	G>A	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs200557771	G>A,C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant, stop gained
rs387906963	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs387906964	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs387906965	A>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs387906966	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs747093432	AG>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs766522434	C>A	Likely-pathogenic	Splice donor variant
rs1240503246	->ATTCC	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1575369255	T>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant
rs1575372587	CTCT>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002515	hsa-miR-373-3p	Microarray	15685193
MIRT002515	hsa-miR-373-3p	Microarray;Other	15685193
MIRT020327	hsa-miR-130b-3p	Sequencing	20371350
MIRT028103	hsa-miR-93-5p	Sequencing	20371350
MIRT031214	hsa-miR-19b-3p	Sequencing	20371350
MIRT049010	hsa-miR-92a-3p	CLASH	23622248
MIRT044011	hsa-miR-378a-5p	CLASH	23622248
MIRT041649	hsa-miR-484	CLASH	23622248
MIRT040067	hsa-miR-615-3p	CLASH	23622248
MIRT557737	hsa-miR-595	PAR-CLIP	21572407
MIRT557736	hsa-miR-340-3p	PAR-CLIP	21572407
MIRT557735	hsa-miR-6827-3p	PAR-CLIP	21572407
MIRT557734	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT557733	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT557732	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT557731	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT557730	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT557729	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT557728	hsa-miR-2052	PAR-CLIP	21572407
MIRT557727	hsa-miR-19a-5p	PAR-CLIP	21572407
MIRT557726	hsa-miR-19b-1-5p	PAR-CLIP	21572407
MIRT557725	hsa-miR-19b-2-5p	PAR-CLIP	21572407
MIRT092155	hsa-miR-578	PAR-CLIP	21572407
MIRT548153	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT548152	hsa-miR-4803	PAR-CLIP	21572407
MIRT548151	hsa-miR-4511	PAR-CLIP	21572407
MIRT548150	hsa-miR-212-5p	PAR-CLIP	21572407
MIRT548149	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT548148	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT548147	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT548146	hsa-miR-1253	PAR-CLIP	21572407
MIRT548145	hsa-miR-6770-5p	PAR-CLIP	21572407
MIRT548144	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT548142	hsa-miR-6077	PAR-CLIP	21572407
MIRT548143	hsa-miR-502-5p	PAR-CLIP	21572407
MIRT548141	hsa-miR-6079	PAR-CLIP	21572407
MIRT548153	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT548152	hsa-miR-4803	PAR-CLIP	21572407
MIRT548151	hsa-miR-4511	PAR-CLIP	21572407
MIRT548150	hsa-miR-212-5p	PAR-CLIP	21572407
MIRT548149	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT548148	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT548147	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT548146	hsa-miR-1253	PAR-CLIP	21572407
MIRT548145	hsa-miR-6770-5p	PAR-CLIP	21572407
MIRT548144	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT548142	hsa-miR-6077	PAR-CLIP	21572407
MIRT548143	hsa-miR-502-5p	PAR-CLIP	21572407
MIRT548141	hsa-miR-6079	PAR-CLIP	21572407
MIRT440603	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440602	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440601	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440600	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440603	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440602	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT727628	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT727627	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT028103	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT727626	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440601	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440600	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT557737	hsa-miR-595	PAR-CLIP	21572407
MIRT557736	hsa-miR-340-3p	PAR-CLIP	21572407
MIRT557735	hsa-miR-6827-3p	PAR-CLIP	21572407
MIRT557734	hsa-miR-3160-5p	PAR-CLIP	21572407
MIRT557733	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT557732	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT557731	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT557730	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT557729	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT557728	hsa-miR-2052	PAR-CLIP	21572407
MIRT557727	hsa-miR-19a-5p	PAR-CLIP	21572407
MIRT557726	hsa-miR-19b-1-5p	PAR-CLIP	21572407
MIRT557725	hsa-miR-19b-2-5p	PAR-CLIP	21572407
MIRT092155	hsa-miR-578	PAR-CLIP	21572407
MIRT548153	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT548152	hsa-miR-4803	PAR-CLIP	21572407
MIRT548151	hsa-miR-4511	PAR-CLIP	21572407
MIRT548150	hsa-miR-212-5p	PAR-CLIP	21572407
MIRT548149	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT548148	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT548147	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT548146	hsa-miR-1253	PAR-CLIP	21572407
MIRT548145	hsa-miR-6770-5p	PAR-CLIP	21572407
MIRT548144	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT548142	hsa-miR-6077	PAR-CLIP	21572407
MIRT548143	hsa-miR-502-5p	PAR-CLIP	21572407
MIRT548141	hsa-miR-6079	PAR-CLIP	21572407
MIRT548153	hsa-miR-1252-3p	PAR-CLIP	21572407
MIRT548152	hsa-miR-4803	PAR-CLIP	21572407
MIRT548151	hsa-miR-4511	PAR-CLIP	21572407
MIRT548150	hsa-miR-212-5p	PAR-CLIP	21572407
MIRT548149	hsa-miR-3189-3p	PAR-CLIP	21572407
MIRT548148	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT548147	hsa-miR-203a-3p	PAR-CLIP	21572407
MIRT548146	hsa-miR-1253	PAR-CLIP	21572407
MIRT548145	hsa-miR-6770-5p	PAR-CLIP	21572407
MIRT548144	hsa-miR-7-5p	PAR-CLIP	21572407
MIRT548142	hsa-miR-6077	PAR-CLIP	21572407
MIRT548143	hsa-miR-502-5p	PAR-CLIP	21572407
MIRT548141	hsa-miR-6079	PAR-CLIP	21572407
MIRT727628	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR	38482429
MIRT1007566	hsa-miR-1184	CLIP-seq
MIRT1007567	hsa-miR-1205	CLIP-seq
MIRT1007568	hsa-miR-1294	CLIP-seq
MIRT1007569	hsa-miR-135a	CLIP-seq
MIRT1007570	hsa-miR-135b	CLIP-seq
MIRT1007571	hsa-miR-142-5p	CLIP-seq
MIRT1007572	hsa-miR-298	CLIP-seq
MIRT1007573	hsa-miR-302a	CLIP-seq
MIRT1007574	hsa-miR-302b	CLIP-seq
MIRT1007575	hsa-miR-302c	CLIP-seq
MIRT1007576	hsa-miR-302d	CLIP-seq
MIRT1007577	hsa-miR-302e	CLIP-seq
MIRT1007578	hsa-miR-3119	CLIP-seq
MIRT1007579	hsa-miR-3123	CLIP-seq
MIRT1007580	hsa-miR-3151	CLIP-seq
MIRT1007581	hsa-miR-3158-5p	CLIP-seq
MIRT1007582	hsa-miR-3187-3p	CLIP-seq
MIRT1007583	hsa-miR-323-5p	CLIP-seq
MIRT1007584	hsa-miR-346	CLIP-seq
MIRT1007585	hsa-miR-3622a-3p	CLIP-seq
MIRT1007586	hsa-miR-3622b-3p	CLIP-seq
MIRT1007587	hsa-miR-3663-3p	CLIP-seq
MIRT1007588	hsa-miR-3665	CLIP-seq
MIRT1007589	hsa-miR-372	CLIP-seq
MIRT1007590	hsa-miR-373	CLIP-seq
MIRT1007591	hsa-miR-4288	CLIP-seq
MIRT1007592	hsa-miR-4434	CLIP-seq
MIRT1007593	hsa-miR-4435	CLIP-seq
MIRT1007594	hsa-miR-4474-3p	CLIP-seq
MIRT1007595	hsa-miR-4477a	CLIP-seq
MIRT1007596	hsa-miR-4516	CLIP-seq
MIRT1007597	hsa-miR-4701-5p	CLIP-seq
MIRT1007598	hsa-miR-4710	CLIP-seq
MIRT1007599	hsa-miR-4727-5p	CLIP-seq
MIRT1007600	hsa-miR-4760-3p	CLIP-seq
MIRT1007601	hsa-miR-4768-3p	CLIP-seq
MIRT1007602	hsa-miR-4769-3p	CLIP-seq
MIRT1007603	hsa-miR-4792	CLIP-seq
MIRT738495	hsa-miR-486-3p	CLIP-seq
MIRT1007604	hsa-miR-520a-3p	CLIP-seq
MIRT1007605	hsa-miR-520b	CLIP-seq
MIRT1007606	hsa-miR-520c-3p	CLIP-seq
MIRT1007607	hsa-miR-520d-3p	CLIP-seq
MIRT1007608	hsa-miR-520e	CLIP-seq
MIRT1007609	hsa-miR-520f	CLIP-seq
MIRT1007610	hsa-miR-544	CLIP-seq
MIRT1007611	hsa-miR-544b	CLIP-seq
MIRT1007612	hsa-miR-548a-5p	CLIP-seq
MIRT1007613	hsa-miR-548ab	CLIP-seq
MIRT1007614	hsa-miR-548ak	CLIP-seq
MIRT1007615	hsa-miR-548b-5p	CLIP-seq
MIRT1007616	hsa-miR-548c-3p	CLIP-seq
MIRT1007617	hsa-miR-548c-5p	CLIP-seq
MIRT1007618	hsa-miR-548d-5p	CLIP-seq
MIRT1007619	hsa-miR-548h	CLIP-seq
MIRT1007620	hsa-miR-548i	CLIP-seq
MIRT1007621	hsa-miR-548j	CLIP-seq
MIRT1007622	hsa-miR-548k	CLIP-seq
MIRT1007623	hsa-miR-548l	CLIP-seq
MIRT1007624	hsa-miR-548s	CLIP-seq
MIRT1007625	hsa-miR-548w	CLIP-seq
MIRT1007626	hsa-miR-548y	CLIP-seq
MIRT1007627	hsa-miR-559	CLIP-seq
MIRT1007628	hsa-miR-588	CLIP-seq
MIRT1007629	hsa-miR-604	CLIP-seq
MIRT1007630	hsa-miR-622	CLIP-seq
MIRT1007631	hsa-miR-632	CLIP-seq
MIRT1007632	hsa-miR-647	CLIP-seq
MIRT1007633	hsa-miR-654-3p	CLIP-seq
MIRT1007634	hsa-miR-657	CLIP-seq
MIRT1007635	hsa-miR-665	CLIP-seq
MIRT1007636	hsa-miR-876-3p	CLIP-seq
MIRT1007637	hsa-miR-944	CLIP-seq
MIRT738500	hsa-miR-1266	CLIP-seq
MIRT738494	hsa-miR-1910	CLIP-seq
MIRT738498	hsa-miR-3127-5p	CLIP-seq
MIRT738497	hsa-miR-3918	CLIP-seq
MIRT738499	hsa-miR-4518	CLIP-seq
MIRT738495	hsa-miR-486-3p	CLIP-seq
MIRT738496	hsa-miR-564	CLIP-seq
MIRT1007566	hsa-miR-1184	CLIP-seq
MIRT1007567	hsa-miR-1205	CLIP-seq
MIRT1998523	hsa-miR-1915	CLIP-seq
MIRT1998524	hsa-miR-1976	CLIP-seq
MIRT1007572	hsa-miR-298	CLIP-seq
MIRT1998525	hsa-miR-3120-3p	CLIP-seq
MIRT1007580	hsa-miR-3151	CLIP-seq
MIRT1007581	hsa-miR-3158-5p	CLIP-seq
MIRT1998526	hsa-miR-3194-3p	CLIP-seq
MIRT1007584	hsa-miR-346	CLIP-seq
MIRT1007588	hsa-miR-3665	CLIP-seq
MIRT1007591	hsa-miR-4288	CLIP-seq
MIRT1007593	hsa-miR-4435	CLIP-seq
MIRT1007595	hsa-miR-4477a	CLIP-seq
MIRT1998527	hsa-miR-4713-3p	CLIP-seq
MIRT1998528	hsa-miR-4726-3p	CLIP-seq
MIRT1007600	hsa-miR-4760-3p	CLIP-seq
MIRT738495	hsa-miR-486-3p	CLIP-seq
MIRT1998529	hsa-miR-494	CLIP-seq
MIRT1007611	hsa-miR-544b	CLIP-seq
MIRT1998530	hsa-miR-605	CLIP-seq
MIRT1007630	hsa-miR-622	CLIP-seq
MIRT1007631	hsa-miR-632	CLIP-seq
MIRT1007633	hsa-miR-654-3p	CLIP-seq
MIRT1007634	hsa-miR-657	CLIP-seq
MIRT1998531	hsa-miR-7	CLIP-seq
MIRT1007637	hsa-miR-944	CLIP-seq
MIRT2232240	hsa-miR-103a	CLIP-seq
MIRT2232241	hsa-miR-106a	CLIP-seq
MIRT2232242	hsa-miR-106b	CLIP-seq
MIRT2232243	hsa-miR-107	CLIP-seq
MIRT1007567	hsa-miR-1205	CLIP-seq
MIRT2232244	hsa-miR-1258	CLIP-seq
MIRT738500	hsa-miR-1266	CLIP-seq
MIRT2232245	hsa-miR-129-5p	CLIP-seq
MIRT2232246	hsa-miR-130a	CLIP-seq
MIRT2232247	hsa-miR-130b	CLIP-seq
MIRT2232248	hsa-miR-138	CLIP-seq
MIRT1007571	hsa-miR-142-5p	CLIP-seq
MIRT2232249	hsa-miR-149	CLIP-seq
MIRT2232250	hsa-miR-17	CLIP-seq
MIRT738494	hsa-miR-1910	CLIP-seq
MIRT1998523	hsa-miR-1915	CLIP-seq
MIRT2232251	hsa-miR-20a	CLIP-seq
MIRT2232252	hsa-miR-20b	CLIP-seq
MIRT2232253	hsa-miR-216b	CLIP-seq
MIRT2232254	hsa-miR-22	CLIP-seq
MIRT2232255	hsa-miR-224	CLIP-seq
MIRT2232256	hsa-miR-2467-3p	CLIP-seq
MIRT1007572	hsa-miR-298	CLIP-seq
MIRT2232257	hsa-miR-301a	CLIP-seq
MIRT2232258	hsa-miR-301b	CLIP-seq
MIRT2232259	hsa-miR-3064-5p	CLIP-seq
MIRT2232260	hsa-miR-3117-5p	CLIP-seq
MIRT1007578	hsa-miR-3119	CLIP-seq
MIRT1998525	hsa-miR-3120-3p	CLIP-seq
MIRT738498	hsa-miR-3127-5p	CLIP-seq
MIRT1007581	hsa-miR-3158-5p	CLIP-seq
MIRT2232261	hsa-miR-3159	CLIP-seq
MIRT2232262	hsa-miR-3162-5p	CLIP-seq
MIRT2232263	hsa-miR-3163	CLIP-seq
MIRT1007582	hsa-miR-3187-3p	CLIP-seq
MIRT1998526	hsa-miR-3194-3p	CLIP-seq
MIRT2232264	hsa-miR-342-5p	CLIP-seq
MIRT2232265	hsa-miR-3609	CLIP-seq
MIRT2232266	hsa-miR-3614-3p	CLIP-seq
MIRT1007587	hsa-miR-3663-3p	CLIP-seq
MIRT1007588	hsa-miR-3665	CLIP-seq
MIRT2232267	hsa-miR-3666	CLIP-seq
MIRT2232268	hsa-miR-3678-3p	CLIP-seq
MIRT2232269	hsa-miR-3692	CLIP-seq
MIRT2232270	hsa-miR-370	CLIP-seq
MIRT738497	hsa-miR-3918	CLIP-seq
MIRT2232271	hsa-miR-3928	CLIP-seq
MIRT2232272	hsa-miR-409-3p	CLIP-seq
MIRT2232273	hsa-miR-4264	CLIP-seq
MIRT2232274	hsa-miR-4267	CLIP-seq
MIRT2232275	hsa-miR-4275	CLIP-seq
MIRT2232276	hsa-miR-4295	CLIP-seq
MIRT2232277	hsa-miR-4297	CLIP-seq
MIRT2232278	hsa-miR-4317	CLIP-seq
MIRT1007593	hsa-miR-4435	CLIP-seq
MIRT2232279	hsa-miR-4453	CLIP-seq
MIRT2232280	hsa-miR-4455	CLIP-seq
MIRT2232281	hsa-miR-4456	CLIP-seq
MIRT2232282	hsa-miR-4468	CLIP-seq
MIRT2232283	hsa-miR-4476	CLIP-seq
MIRT2232284	hsa-miR-4514	CLIP-seq
MIRT2232285	hsa-miR-4517	CLIP-seq
MIRT738499	hsa-miR-4518	CLIP-seq
MIRT2232286	hsa-miR-4538	CLIP-seq
MIRT2232287	hsa-miR-454	CLIP-seq
MIRT2232288	hsa-miR-4651	CLIP-seq
MIRT2232289	hsa-miR-4663	CLIP-seq
MIRT2232290	hsa-miR-4664-5p	CLIP-seq
MIRT2232291	hsa-miR-4692	CLIP-seq
MIRT1007597	hsa-miR-4701-5p	CLIP-seq
MIRT2232292	hsa-miR-4717-3p	CLIP-seq
MIRT2232293	hsa-miR-4743	CLIP-seq
MIRT1007601	hsa-miR-4768-3p	CLIP-seq
MIRT2232294	hsa-miR-4774-5p	CLIP-seq
MIRT2232295	hsa-miR-4794	CLIP-seq
MIRT2232296	hsa-miR-4795-3p	CLIP-seq
MIRT2232297	hsa-miR-4796-3p	CLIP-seq
MIRT2232298	hsa-miR-485-5p	CLIP-seq
MIRT738495	hsa-miR-486-3p	CLIP-seq
MIRT1998529	hsa-miR-494	CLIP-seq
MIRT2232299	hsa-miR-512-3p	CLIP-seq
MIRT2232300	hsa-miR-515-5p	CLIP-seq
MIRT2232301	hsa-miR-519a	CLIP-seq
MIRT2232302	hsa-miR-519b-3p	CLIP-seq
MIRT2232303	hsa-miR-519c-3p	CLIP-seq
MIRT2232304	hsa-miR-519d	CLIP-seq
MIRT2232305	hsa-miR-545	CLIP-seq
MIRT1007612	hsa-miR-548a-5p	CLIP-seq
MIRT1007613	hsa-miR-548ab	CLIP-seq
MIRT2232306	hsa-miR-548ah	CLIP-seq
MIRT1007614	hsa-miR-548ak	CLIP-seq
MIRT1007615	hsa-miR-548b-5p	CLIP-seq
MIRT1007616	hsa-miR-548c-3p	CLIP-seq
MIRT1007617	hsa-miR-548c-5p	CLIP-seq
MIRT1007618	hsa-miR-548d-5p	CLIP-seq
MIRT1007619	hsa-miR-548h	CLIP-seq
MIRT1007620	hsa-miR-548i	CLIP-seq
MIRT1007621	hsa-miR-548j	CLIP-seq
MIRT1007622	hsa-miR-548k	CLIP-seq
MIRT1007623	hsa-miR-548l	CLIP-seq
MIRT1007624	hsa-miR-548s	CLIP-seq
MIRT1007625	hsa-miR-548w	CLIP-seq
MIRT1007626	hsa-miR-548y	CLIP-seq
MIRT1007627	hsa-miR-559	CLIP-seq
MIRT2232307	hsa-miR-561	CLIP-seq
MIRT738496	hsa-miR-564	CLIP-seq
MIRT1007628	hsa-miR-588	CLIP-seq
MIRT2232308	hsa-miR-608	CLIP-seq
MIRT2232309	hsa-miR-609	CLIP-seq
MIRT1007630	hsa-miR-622	CLIP-seq
MIRT2232310	hsa-miR-629	CLIP-seq
MIRT2232311	hsa-miR-759	CLIP-seq
MIRT2232312	hsa-miR-765	CLIP-seq
MIRT2232313	hsa-miR-93	CLIP-seq
MIRT2388292	hsa-miR-1224-5p	CLIP-seq
MIRT2388293	hsa-miR-1245b-3p	CLIP-seq
MIRT2388294	hsa-miR-1304	CLIP-seq
MIRT2388295	hsa-miR-30a	CLIP-seq
MIRT2388296	hsa-miR-30b	CLIP-seq
MIRT2388297	hsa-miR-30c	CLIP-seq
MIRT2388298	hsa-miR-30d	CLIP-seq
MIRT2388299	hsa-miR-30e	CLIP-seq
MIRT1007580	hsa-miR-3151	CLIP-seq
MIRT2232262	hsa-miR-3162-5p	CLIP-seq
MIRT2232269	hsa-miR-3692	CLIP-seq
MIRT2388300	hsa-miR-3915	CLIP-seq
MIRT2388301	hsa-miR-4689	CLIP-seq
MIRT2388302	hsa-miR-4751	CLIP-seq
MIRT2232307	hsa-miR-561	CLIP-seq
MIRT1007572	hsa-miR-298	CLIP-seq
MIRT1007580	hsa-miR-3151	CLIP-seq
MIRT1007588	hsa-miR-3665	CLIP-seq
MIRT738495	hsa-miR-486-3p	CLIP-seq
MIRT1007634	hsa-miR-657	CLIP-seq
MIRT2535992	hsa-miR-1272	CLIP-seq
MIRT2535993	hsa-miR-1323	CLIP-seq
MIRT2535994	hsa-miR-2116	CLIP-seq
MIRT2232260	hsa-miR-3117-5p	CLIP-seq
MIRT2232262	hsa-miR-3162-5p	CLIP-seq
MIRT2232263	hsa-miR-3163	CLIP-seq
MIRT2535995	hsa-miR-3185	CLIP-seq
MIRT2232264	hsa-miR-342-5p	CLIP-seq
MIRT2535996	hsa-miR-3622b-5p	CLIP-seq
MIRT1007588	hsa-miR-3665	CLIP-seq
MIRT2232269	hsa-miR-3692	CLIP-seq
MIRT2535997	hsa-miR-371b-5p	CLIP-seq
MIRT2535998	hsa-miR-3910	CLIP-seq
MIRT2535999	hsa-miR-4257	CLIP-seq
MIRT2536000	hsa-miR-4276	CLIP-seq
MIRT2232282	hsa-miR-4468	CLIP-seq
MIRT2536001	hsa-miR-4481	CLIP-seq
MIRT2536002	hsa-miR-4490	CLIP-seq
MIRT2232285	hsa-miR-4517	CLIP-seq
MIRT2536003	hsa-miR-4635	CLIP-seq
MIRT2536004	hsa-miR-4642	CLIP-seq
MIRT2232288	hsa-miR-4651	CLIP-seq
MIRT2232290	hsa-miR-4664-5p	CLIP-seq
MIRT2536005	hsa-miR-4677-3p	CLIP-seq
MIRT2536006	hsa-miR-4677-5p	CLIP-seq
MIRT2536007	hsa-miR-4679	CLIP-seq
MIRT1007598	hsa-miR-4710	CLIP-seq
MIRT2536008	hsa-miR-4745-5p	CLIP-seq
MIRT2536009	hsa-miR-4758-5p	CLIP-seq
MIRT2232294	hsa-miR-4774-5p	CLIP-seq
MIRT1007603	hsa-miR-4792	CLIP-seq
MIRT2536010	hsa-miR-493	CLIP-seq
MIRT2536011	hsa-miR-526b	CLIP-seq
MIRT2536012	hsa-miR-548aa	CLIP-seq
MIRT2536013	hsa-miR-548o	CLIP-seq
MIRT2232307	hsa-miR-561	CLIP-seq
MIRT2232308	hsa-miR-608	CLIP-seq
MIRT2536014	hsa-miR-760	CLIP-seq
MIRT2535992	hsa-miR-1272	CLIP-seq
MIRT2535993	hsa-miR-1323	CLIP-seq
MIRT2535994	hsa-miR-2116	CLIP-seq
MIRT2232260	hsa-miR-3117-5p	CLIP-seq
MIRT2681239	hsa-miR-3138	CLIP-seq
MIRT2232262	hsa-miR-3162-5p	CLIP-seq
MIRT2232263	hsa-miR-3163	CLIP-seq
MIRT2535995	hsa-miR-3185	CLIP-seq
MIRT2535996	hsa-miR-3622b-5p	CLIP-seq
MIRT2535997	hsa-miR-371b-5p	CLIP-seq
MIRT2535999	hsa-miR-4257	CLIP-seq
MIRT2536000	hsa-miR-4276	CLIP-seq
MIRT2681240	hsa-miR-4282	CLIP-seq
MIRT2536001	hsa-miR-4481	CLIP-seq
MIRT2232285	hsa-miR-4517	CLIP-seq
MIRT2536003	hsa-miR-4635	CLIP-seq
MIRT2536004	hsa-miR-4642	CLIP-seq
MIRT2536005	hsa-miR-4677-3p	CLIP-seq
MIRT2536006	hsa-miR-4677-5p	CLIP-seq
MIRT2536007	hsa-miR-4679	CLIP-seq
MIRT1007598	hsa-miR-4710	CLIP-seq
MIRT2681241	hsa-miR-4738-3p	CLIP-seq
MIRT2536008	hsa-miR-4745-5p	CLIP-seq
MIRT2536009	hsa-miR-4758-5p	CLIP-seq
MIRT1007603	hsa-miR-4792	CLIP-seq
MIRT2536010	hsa-miR-493	CLIP-seq
MIRT2681242	hsa-miR-513a-3p	CLIP-seq
MIRT2536011	hsa-miR-526b	CLIP-seq
MIRT2536012	hsa-miR-548aa	CLIP-seq
MIRT2536013	hsa-miR-548o	CLIP-seq
MIRT2536014	hsa-miR-760	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20100911, 20562859, 23455924, 24089205, 25855459, 32353859, 32814053, 33060197, 35271311, 36217030
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	20100911
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IBA
GO:0005770	Component	Late endosome	IDA	20100911
GO:0005776	Component	Autophagosome	IBA
GO:0005776	Component	Autophagosome	IDA	20100911
GO:0005776	Component	Autophagosome	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0072383	Process	Plus-end-directed vesicle transport along microtubule	IBA
GO:0072383	Process	Plus-end-directed vesicle transport along microtubule	IMP	20100911
GO:1901098	Process	Positive regulation of autophagosome maturation	IBA
GO:1901098	Process	Positive regulation of autophagosome maturation	IMP	26468287

Other IDs

• MIM: 607182
• HGNC: 14673
• e!Ensembl: ENSG00000163820

Protein

• UniProt ID: Q9BQS8
• Protein name: FYVE and coiled-coil domain-containing protein 1 (Zinc finger FYVE domain-containing protein 7)
• Protein function: May mediate microtubule plus end-directed vesicle transport.
• PDB: 5CX3, 5D94, 7BQI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02759	RUN	15 → 167	RUN domain	Family
  PF01363	FYVE	1168 → 1232	FYVE zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart and skeletal muscle. {ECO:0000269|PubMed:11896456}.
• Sequence:

  MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEK
  ATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADT
  LQQCFMNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAWPTFAR
  RTLTTGSSAYLWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLNNEALEGFDEMRLELD
  QLEVREKQLRERMQQLDRENQELRAAVSQQGEQLQTERERGRTAAEDNVRLTCLVAELQK
  QWEVTQATQNTVKELQTCLQGLELGAAEKEEDYHTALRRLESMLQPLAQELEATRDSLDK
  KNQHLASFPGWLAMAQQKADTASDTKGRQEPIPSDAAQEMQELGEKLQALERERTKVEEV
  NRQQSAQLEQLVKELQLKEDARASLERLVKEMAPLQEELSGKGQEADQLWRRLQELLAHT
  SSWEEELAELRREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQVSQHVSDLEEQKKQLI
  QDKDHLSQQVGMLERLAGPPGPELPVAGEKNEALVPVNSSLQEAWGKPEEEQRGLQEAQL
  DDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQRESAIQGSL
  ASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAQMAEKEAILQSKEGECQQLREEVEQCQ
  QLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPTDNEARELAAQLALSQAQLEV
  HQGEVQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKTLVQQLKEQNEALNRA
  HVQELLQCSEREGALQEERADEAQQREEELRALQEELSQAKCSSEEAQLEHAELQEQLHR
  ANTDTAELGIQVCALTVEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQQEKES
  LQEKLKAAKAAAGSLPGLQAQLAQAEQRAQSLQEAAHQELNTLKFQLSAEIMDYQSRLKN
  AGEECKSLRGQLEEQGRQLQAAEEAVEKLKATQADMGEKLSCTSNHLAECQAAMLRKDKE
  GAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEER
  LIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMVRRHHCRICGR
  IFCYYCCNNYVLSKHGGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGP
  QATGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNAAEQDTTST
  SLTPEDTEDMPVGQDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPIT
  VAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRT
  PGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDFL

• Sequence length: 1478

Pathways

KEGG:

Salmonella infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Abnormality of the eye	Likely pathogenic; Pathogenic	rs764164884	RCV001814428	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cataract 18	Likely pathogenic; Pathogenic	rs764164884, rs2125859216, rs777269054, rs200679450, rs2125859204, rs73830668, rs2125846016, rs2529040601, rs775542878, rs774761672, rs387906963, rs387906964, rs1240503246, rs387906965, rs387906966, rs747093432, rs766522434, rs1575369255, rs200557771, rs768945306, rs1706240480	RCV005094751 RCV001783320 RCV001905836 RCV001955541 RCV001967448 RCV001953655 RCV002011903 RCV002289077 RCV002664304 RCV003226076 RCV000023620 RCV000023621 RCV000023623 RCV000023624 RCV000023625 RCV000496018 RCV001613393 RCV000817362 RCV000855400 RCV001262442 RCV001262245	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
FYCO1-related disorder	Pathogenic; Likely pathogenic	rs372348872, rs749045427, rs933498193, rs2528977475	RCV003402847 RCV003896386 RCV003946784 RCV003954892	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, AUTOSOMAL RECESSIVE CONGENITAL 2	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL TOTAL CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental cataract	Benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET NUCLEAR CATARACT	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOTAL EARLY-ONSET CATARACT	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31772661		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26517091	Associate	★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35018543	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28623323	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31772661		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	21636066, 29914532, 32355443, 33339270, 33767456, 34872443, 35638468, 36061348	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cataract autosomal recessive congenital 2	Congenital cataract	Pubtator	33767456	Associate	★☆☆☆☆ Found in Text Mining only
Cataract, autosomal recessive congenital 2	Cataract	GENOMICS_ENGLAND_DG	11519376		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract, autosomal recessive congenital 2	Cataract	UNIPROT_DG	21636066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract, autosomal recessive congenital 2	Cataract	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract, autosomal recessive congenital 2	Cataract	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28089833, 28623323		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28623323	Associate	★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	21636066		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital cataract	Congenital Cataract	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital total cataract	Congenital Cataract	ORPHANET_DG	26622071		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Early-onset nuclear cataract	Cataract	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	28009083		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	28777108, 29611059		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	26517091	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35018543	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31772661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25766321, 31547840		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25766321, 28089833, 29196475		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28009083		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31221560		★☆☆☆☆ Found in Text Mining only
Nuclear cataract	Cataract	ORPHANET_DG	21636066, 24384146		★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	ORPHANET_DG	21636066, 24384146		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37398645	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	29747217		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31078570		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25766321, 31547840		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25766321	Stimulate	★☆☆☆☆ Found in Text Mining only
Total early-onset cataract	Cataract	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28381171	Inhibit	★☆☆☆☆ Found in Text Mining only